SitesBLAST
Comparing WP_004514075.1 NCBI__GCF_000012925.1:WP_004514075.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
49% identity, 95% coverage: 15:436/443 of query aligns to 1:391/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (= L226), R200 (= R245), M281 (≠ R326), G282 (= G327), R307 (= R352), A308 (≠ S353), Q320 (= Q365), V321 (= V366), G322 (= G367), Q323 (= Q368), T324 (= T369), G337 (= G382), I338 (= I383), S339 (= S384), Q343 (= Q388), H344 (= H389), N358 (= N403), K359 (≠ R404), L377 (= L422)
- binding iron/sulfur cluster: C7 (= C21), C10 (= C24), C13 (= C28), C17 (= C32), P18 (= P33), C35 (= C52), T36 (≠ I53), N37 (≠ G54), C38 (= C55), C41 (= C58), C45 (= C62), A49 (= A66)
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
49% identity, 75% coverage: 113:443/443 of query aligns to 3:331/331 of 5ol2A
- binding calcium ion: E75 (= E185), D188 (= D297)
- binding flavin-adenine dinucleotide: T117 (= T227), R136 (= R245), I147 (= I256), G216 (= G325), R217 (= R326), G218 (= G327), S242 (= S351), R243 (= R352), A244 (≠ S353), Q256 (= Q365), V257 (= V366), G258 (= G367), T260 (= T369), G273 (= G382), I274 (= I383), S275 (= S384), A277 (= A386), Q279 (= Q388), H280 (= H389), N294 (= N403), K295 (≠ R404), D312 (= D421), V313 (≠ L422)
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
51% identity, 73% coverage: 114:436/443 of query aligns to 7:330/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (= T227), R140 (= R245), T142 (≠ A247), G219 (= G325), K220 (≠ R326), G221 (= G327), S245 (= S351), R246 (= R352), A247 (≠ S353), Q259 (= Q365), V260 (= V366), G261 (= G367), Q262 (= Q368), T263 (= T369), G276 (= G382), S278 (= S384), Q282 (= Q388), H283 (= H389), N297 (= N403), I298 (≠ R404), L316 (= L422)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
44% identity, 74% coverage: 112:439/443 of query aligns to 11:338/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (= L226), R144 (= R245), I155 (= I256), G224 (= G325), R225 (= R326), G226 (= G327), S250 (= S351), R251 (= R352), A252 (≠ S353), Q264 (= Q365), V265 (= V366), G266 (= G367), Q267 (= Q368), S268 (≠ T369), G281 (= G382), I282 (= I383), S283 (= S384), S285 (≠ A386), Q287 (= Q388), H288 (= H389), N302 (= N403), K303 (≠ R404), D320 (= D421), A321 (≠ L422)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
41% identity, 73% coverage: 109:433/443 of query aligns to 8:331/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (= L226), T126 (= T227), R144 (= R245), I155 (= I256), R224 (= R326), G225 (= G327), T249 (≠ S351), R250 (= R352), Q263 (= Q365), I264 (≠ V366), G265 (= G367), L266 (≠ Q368), S267 (≠ T369), G280 (= G382), I281 (= I383), S282 (= S384), Q286 (= Q388), N301 (= N403), S302 (≠ R404), D303 (= D405), D319 (= D421), L320 (= L422)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
34% identity, 75% coverage: 105:435/443 of query aligns to 13:332/333 of P13804
- 20:204 (vs. 112:311, 18% identical) Domain I
- G116 (= G211) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (≠ H271) to I: decreased protein stability; dbSNP:rs1801591
- R223 (= R326) binding
- S248 (= S351) binding
- R249 (= R352) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (= VGQT 366:369) binding
- T266 (= T369) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 384:389) binding
- N300 (= N403) binding
- DL 318:319 (= DL 421:422) binding
Sites not aligning to the query:
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
34% identity, 73% coverage: 111:435/443 of query aligns to 1:314/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G325), R205 (= R326), S230 (= S351), R231 (= R352), A232 (≠ S353), Q244 (= Q365), V245 (= V366), G246 (= G367), T248 (= T369), G261 (= G382), I262 (= I383), S263 (= S384), A265 (= A386), Q267 (= Q388), H268 (= H389), N282 (= N403), K283 (≠ R404), D300 (= D421), L301 (= L422)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
63% identity, 27% coverage: 314:433/443 of query aligns to 188:307/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G325), R200 (= R326), G201 (= G327), S225 (= S351), R226 (= R352), A227 (≠ S353), Q239 (= Q365), V240 (= V366), G241 (= G367), T243 (= T369), G256 (= G382), I257 (= I383), S258 (= S384), A260 (= A386), Q262 (= Q388), H263 (= H389), N277 (= N403), K278 (≠ R404), D295 (= D421), L296 (= L422)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
38% identity, 56% coverage: 189:434/443 of query aligns to 58:292/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G325), R184 (= R326), G185 (= G327), S209 (= S351), R210 (= R352), Q223 (= Q365), I224 (≠ V366), G225 (= G367), T227 (= T369), G240 (= G382), V241 (≠ I383), S242 (= S384), A244 (= A386), Q246 (= Q388), H247 (= H389), N261 (= N403), K262 (≠ R404), D279 (= D421), Y280 (≠ L422)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
29% identity, 72% coverage: 114:433/443 of query aligns to 4:319/321 of P53571
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
29% identity, 72% coverage: 114:433/443 of query aligns to 3:318/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G325), R210 (= R326), G211 (= G327), S235 (= S351), A236 (≠ R352), P237 (≠ S353), Q249 (= Q365), V250 (= V366), G251 (= G367), Q252 (= Q368), S253 (≠ T369), G267 (= G382), I268 (= I383), S269 (= S384), S271 (≠ A386), Q273 (= Q388), H274 (= H389), N288 (= N403), T289 (≠ R404), D306 (= D421), I307 (≠ L422)
8a8oD Paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a (see paper)
38% identity, 14% coverage: 13:74/443 of query aligns to 1:62/102 of 8a8oD
- binding iron/sulfur cluster: I2 (≠ A14), C9 (= C21), I10 (= I22), G11 (≠ A23), C12 (= C24), G13 (= G25), C15 (= C28), C19 (= C32), P20 (= P33), S32 (≠ P45), C40 (= C52), W41 (≠ I53), D42 (≠ G54), C43 (= C55), A44 (≠ L56), C46 (= C58), C50 (= C62), I55 (≠ L67)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
44% identity, 11% coverage: 18:67/443 of query aligns to 579:627/630 of 8a6tB
- binding iron/sulfur cluster: C582 (= C21), I583 (= I22), C585 (= C24), C588 (= C28), C592 (= C32), A596 (= A36), I597 (= I37), I607 (= I47), C612 (= C52), C618 (= C58), C622 (= C62), K624 (≠ A64), A626 (= A66), I627 (≠ L67)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding flavin mononucleotide: 201, 227, 230, 355, 535, 536
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 320, 337, 340, 341, 342, 433
- binding iron/sulfur cluster: 487, 488, 489, 491, 494, 534, 536, 537, 575, 577
- binding zinc ion: 471, 558, 564
Query Sequence
>WP_004514075.1 NCBI__GCF_000012925.1:WP_004514075.1
MTEPKKIKKPRGTARPIPGKCIACGARCQSACPVDAIEMSDAGEPIILSEKCIGCLKCVK
VCPADALEMFFTPEELKILEELARQQAAGAAPAVEEEDAEEAALAQMLAAYRGVWVFVEQ
TEGEPAKVSWELMGVGAQLARDIGTELCAIVIGHGVEHLCREAFSYGATKAYLMDQDVFR
FYRTEPYLDACCHLIDKYKPEIILMGATGMGRDLAGAVATRVKTGLTADCTGLDVDDKRN
LRQTRPAFGGNIMATIMCDKFRPQMATVRPHVMPMPERMEGATGAIVREQITLNEADILT
KVIEIIRDTKVGVDIAGAEFIVSGGRGLMGPENFAMLQELADELGGVVGASRSAVDAGWM
PHDRQVGQTGKTVRPKIYIACGISGAIQHLVGMQDSDVVIAINRDKEAPIFQVATYGIVG
DLFKIVPAITSQLRELKASKRKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory