SitesBLAST
Comparing WP_004514651.1 NCBI__GCF_000012925.1:WP_004514651.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yi7A Anthranilate bound at active site of anthranilate phosphoribosyl transferase from acinetobacter (anprt; trpd)
40% identity, 99% coverage: 2:348/350 of query aligns to 4:326/331 of 4yi7A
4zojA Methylsulfanyl-containing inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:333/341 of 4zojA
- active site: V82 (= V93)
- binding 4-methyl-2-{[2-methyl-6-(methylsulfanyl)phenyl]amino}benzoic acid: N114 (= N125), A155 (= A166), P156 (= P167), H159 (= H170), Y162 (≠ M173), R169 (= R180), G182 (= G193)
- binding magnesium ion: S95 (= S106), D227 (= D239), E228 (= E240), E228 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G94), G85 (= G96), G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), R115 (= R126), A116 (= A127), A117 (≠ V128), S119 (= S130)
5c7sA Prpp complexed with two mn2+ in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
45% identity, 97% coverage: 6:346/350 of query aligns to 8:336/344 of 5c7sA
- active site: V83 (= V93)
- binding manganese (ii) ion: G84 (= G94), S96 (= S106), D228 (= D239), E229 (= E240), E229 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V83 (= V93), G84 (= G94), G86 (= G96), G87 (= G97), N94 (= N104), S96 (= S106), T97 (= T107), K112 (= K122), N115 (= N125), S120 (= S130)
4zokA Methylsulfonyl-containing inhibitor bound in the substrate capture site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:334/342 of 4zokA
- active site: V82 (= V93)
- binding 4-methyl-2-{[2-methyl-6-(methylsulfonyl)phenyl]amino}benzoic acid: P156 (= P167), R163 (≠ K174), A166 (≠ I177), A167 (≠ G178)
- binding magnesium ion: S95 (= S106), E228 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), A116 (= A127), A117 (≠ V128), S119 (= S130), G122 (= G133)
4zofA Lobenzarit-like inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:334/342 of 4zofA
- active site: V82 (= V93)
- binding 2-[(2-carboxy-5-nitrophenyl)amino]-3-methylbenzoic acid: G113 (= G124), N114 (= N125), A155 (= A166), H159 (= H170), Y162 (≠ M173), R169 (= R180), G182 (= G193)
- binding magnesium ion: S95 (= S106), D227 (= D239), E228 (= E240), E228 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G94), G85 (= G96), G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), A116 (= A127), A117 (≠ V128), S119 (= S130), G122 (= G133)
3r88B Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs145) (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:335/344 of 3r88B
- active site: V82 (= V93)
- binding 2-amino-4,5-dimethoxybenzoic acid: N114 (= N125), A155 (= A166), P156 (= P167), H159 (= H170), Y162 (≠ M173), R163 (≠ K174), A166 (≠ I177)
- binding magnesium ion: S95 (= S106), D227 (= D239), E228 (= E240), E228 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V82 (= V93), G83 (= G94), G85 (= G96), G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), N114 (= N125), A117 (≠ V128), S118 (= S129), S119 (= S130)
5c1rA Stereoisomer of prpp bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyl (anprt; trpd)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:335/343 of 5c1rA
- active site: V82 (= V93)
- binding 5-O-[(R)-hydroxy(phosphonooxy)phosphoryl]-1-O-phosphono-alpha-D-ribofuranose: V82 (= V93), G83 (= G94), G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), R115 (= R126), A117 (≠ V128), S118 (= S129), S119 (= S130)
- binding magnesium ion: D87 (= D98), V89 (≠ T100), S95 (= S106), E228 (= E240)
P9WFX5 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
45% identity, 97% coverage: 6:346/350 of query aligns to 31:361/370 of P9WFX5
- G107 (= G94) binding
- T115 (= T102) binding
- G147 (≠ S134) binding
4n5vA Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 9:338/347 of 4n5vA
- active site: V84 (= V93)
- binding 2-amino-4-fluorobenzoic acid: V84 (= V93), G85 (= G94), H114 (= H123), G115 (= G124), N116 (= N125), A157 (= A166), A157 (= A166), P158 (= P167), H161 (= H170), Y164 (≠ M173), R165 (≠ K174), A168 (≠ I177), R171 (= R180), G184 (= G193)
- binding magnesium ion: S97 (= S106), D229 (= D239), E230 (= E240), E230 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G85 (= G94), G87 (= G96), G88 (= G97), N95 (= N104), S97 (= S106), T98 (= T107), K113 (= K122), A119 (≠ V128), S120 (= S129), S121 (= S130), G124 (= G133)
4n93A Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 8:337/346 of 4n93A
- active site: V83 (= V93)
- binding 2-amino-6-methylbenzoic acid: V83 (= V93), G84 (= G94), T85 (= T95), H113 (= H123), N115 (= N125), N115 (= N125), A156 (= A166), P157 (= P167), H160 (= H170), Y163 (≠ M173), A167 (≠ I177), R170 (= R180), G183 (= G193), P184 (= P194)
- binding magnesium ion: S96 (= S106), D228 (= D239), E229 (= E240), E229 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G94), G86 (= G96), G87 (= G97), N94 (= N104), S96 (= S106), T97 (= T107), K112 (= K122), A117 (= A127), A118 (≠ V128), S120 (= S130), G123 (= G133)
4owuA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 5-methylanthranilate, prpp and magnesium (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 8:338/347 of 4owuA
- active site: V83 (= V93)
- binding 2-azanyl-5-methyl-benzoic acid: N115 (= N125), P157 (= P167), Y163 (≠ M173), R164 (≠ K174), A167 (≠ I177)
- binding magnesium ion: S96 (= S106), D228 (= D239), E229 (= E240), E229 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G94), G86 (= G96), G87 (= G97), N94 (= N104), S96 (= S106), T97 (= T107), K112 (= K122), A118 (≠ V128), S120 (= S130), G123 (= G133)
4owqA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-methylanthranilate, prpp and magnesium (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 8:338/347 of 4owqA
- active site: V83 (= V93)
- binding 2-azanyl-3-methyl-benzoic acid: P157 (= P167), H160 (= H170), Y163 (≠ M173), A167 (≠ I177), R171 (≠ K181)
- binding magnesium ion: S96 (= S106), D228 (= D239), E229 (= E240), E229 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V83 (= V93), G84 (= G94), G86 (= G96), G87 (= G97), N94 (= N104), S96 (= S106), T97 (= T107), K112 (= K122), A117 (= A127), A118 (≠ V128), S120 (= S130), G123 (= G133)
4owoA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 6-fluoroanthranilate, prpp and magnesium (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 9:339/348 of 4owoA
- active site: V84 (= V93)
- binding 2-azanyl-6-fluoranyl-benzoic acid: V84 (= V93), G85 (= G94), T86 (= T95), H114 (= H123), N116 (= N125), N116 (= N125), A157 (= A166), P158 (= P167), H161 (= H170), Y164 (≠ M173), A168 (≠ I177), R171 (= R180), G184 (= G193)
- binding magnesium ion: S97 (= S106), D229 (= D239), E230 (= E240), E230 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V84 (= V93), G85 (= G94), G87 (= G96), G88 (= G97), N95 (= N104), S97 (= S106), T98 (= T107), K113 (= K122), A118 (= A127), A119 (≠ V128), S120 (= S129), S121 (= S130), G124 (= G133)
4giuA Bianthranilate-like analogue bound in inner site of anthranilate phosphoribosyltransferase (anprt; trpd). (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 8:338/346 of 4giuA
- active site: V83 (= V93)
- binding 2-[(2-carboxy-5-methylphenyl)amino]-3-methylbenzoic acid: G114 (= G124), N115 (= N125), A156 (= A166), H160 (= H170), Y163 (≠ M173), R170 (= R180), G183 (= G193)
- binding magnesium ion: S96 (= S106), D228 (= D239), E229 (= E240), E229 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G94), G86 (= G96), G87 (= G97), N94 (= N104), S96 (= S106), T97 (= T107), K112 (= K122), N115 (= N125), A117 (= A127), A118 (≠ V128), S119 (= S129), S120 (= S130), G123 (= G133)
5c2lA Magnesium soaked into the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
45% identity, 97% coverage: 6:346/350 of query aligns to 9:339/349 of 5c2lA
4owmA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-fluoroanthranilate, prpp and magnesium (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:337/346 of 4owmA
- active site: V82 (= V93)
- binding 2-azanyl-3-fluoranyl-benzoic acid: P156 (= P167), H159 (= H170), Y162 (≠ M173), R163 (≠ K174), A166 (≠ I177), R170 (≠ K181)
- binding magnesium ion: S95 (= S106), D227 (= D239), E228 (= E240), E228 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G94), G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), A117 (≠ V128), S118 (= S129), S119 (= S130), G122 (= G133)
4gkmA Bianthranilate-like analogue bound in the outer site of anthranilate phosphoribosyltransferase (anprt; trpd) (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:337/346 of 4gkmA
- active site: V82 (= V93)
- binding 2-[(2-carboxyphenyl)amino]-5-methylbenzoic acid: N114 (= N125), A155 (= A166), P156 (= P167), Y162 (≠ M173), R163 (≠ K174), A166 (≠ I177), R169 (= R180), R170 (≠ K181)
- binding magnesium ion: S95 (= S106), D227 (= D239), E228 (= E240), E228 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), A117 (≠ V128), S118 (= S129), S119 (= S130), G122 (= G133)
3r6cA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs179) (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:337/346 of 3r6cA
- active site: V82 (= V93)
- binding 8-methoxyphenanthro[3,4-d][1,3]dioxole-5,6-dicarboxylic acid: M62 (= M61), N114 (= N125), A155 (= A166), P156 (= P167), H159 (= H170), Y162 (≠ M173), A166 (≠ I177), R169 (= R180), G182 (= G193), T185 (= T196), R239 (≠ E251), A241 (≠ T253), D246 (≠ T258), V301 (= V313), A310 (vs. gap), W312 (vs. gap)
- binding magnesium ion: S95 (= S106), D227 (= D239), E228 (= E240), E228 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G94), G85 (= G96), G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), N114 (= N125), R115 (= R126), A116 (= A127), A117 (≠ V128), S118 (= S129), S119 (= S130), G122 (= G133), G123 (≠ S134)
3qsaA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor tamu-a7)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:337/346 of 3qsaA
- active site: V82 (= V93)
- binding magnesium ion: S95 (= S106), D227 (= D239), E228 (= E240), E228 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G94), G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), A117 (≠ V128), S118 (= S129), S119 (= S130), G122 (= G133)
- binding 4,4,4-trifluoro-1-(4-methoxyphenyl)butane-1,3-dione: M62 (= M61), N114 (= N125), A155 (= A166), P156 (= P167), H159 (= H170), Y162 (≠ M173), R163 (≠ K174), A166 (≠ I177), G182 (= G193)
3qs8A Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs174) (see paper)
45% identity, 97% coverage: 6:346/350 of query aligns to 7:337/346 of 3qs8A
- active site: V82 (= V93)
- binding 2-benzylbenzoic acid: M62 (= M61), G83 (= G94), N114 (= N125), N114 (= N125), A155 (= A166), A155 (= A166), P156 (= P167), Y162 (≠ M173), Y162 (≠ M173), A166 (≠ I177), R169 (= R180), R169 (= R180), R170 (≠ K181), L181 (= L192), G182 (= G193)
- binding magnesium ion: S95 (= S106), D227 (= D239), E228 (= E240), E228 (= E240)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G94), G85 (= G96), G86 (= G97), N93 (= N104), S95 (= S106), T96 (= T107), K111 (= K122), N114 (= N125), A116 (= A127), A117 (≠ V128), S118 (= S129), S119 (= S130), G122 (= G133), E228 (= E240)
Query Sequence
>WP_004514651.1 NCBI__GCF_000012925.1:WP_004514651.1
MIKKAIAKVVERIDLTEAEMIEVMDQIMSGEATPAQIASFITALRMKGETVEEITGAARV
MRDRATPIRVGKGVLDIDRDDINIDQETILDVVGTGGDGTNTFNISTTVSFVVASCGVKV
AKHGNRAVSSACGSADVLESLGVSLDVTPETVENAIARIGIGFLFAPALHGAMKHAIGPR
KEIGIRTIFNILGPLTNPAGADCQVLGVYREDLVEPLAHVLHKLGCKRGFVVFGMDGMDE
ITLTRETRVAEVTREGVTVRTITPEEFGFASCPPGDLRGGDAAGNARIVRSILDGATGPR
RDVVLLNAAYALVAAGKATDPAEGIRLAAEAIDSGRALAKLEELIALTNE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory