Comparing WP_004686360.1 NCBI__GCF_000022745.1:WP_004686360.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 46% coverage: 36:240/446 of query aligns to 37:223/582 of O23492
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 76% coverage: 50:389/446 of query aligns to 28:381/446 of A0A0H2VG78
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 49% coverage: 23:240/446 of query aligns to 35:262/583 of Q9Y7Q9
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 30% coverage: 94:227/446 of query aligns to 93:211/580 of Q9C757
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534) (see paper)
25% identity, 43% coverage: 25:218/446 of query aligns to 39:213/444 of Q8NLB7
Sites not aligning to the query:
8fvzA Pipt y150a
22% identity, 81% coverage: 26:386/446 of query aligns to 2:371/433 of 8fvzA
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
26% identity, 30% coverage: 84:218/446 of query aligns to 203:337/727 of Q9Z2I6
Sites not aligning to the query:
8uo9A Structure of synaptic vesicle protein 2a in complex with a nanobody (see paper)
27% identity, 26% coverage: 84:201/446 of query aligns to 65:181/555 of 8uo9A
Sites not aligning to the query:
>WP_004686360.1 NCBI__GCF_000022745.1:WP_004686360.1
MNNAGMHVDANGEVEAPHDAHDTRRRVYAIVASASGNLVEWYDFYVYSFGALYFASQFFP
AEDQTSQLLNAAAIFAAGFLMRPIGGWLFGRIADKLGRRLSMLVSVTMMCFGSFAIAILP
TYETIGVLAPFLLLVVRLVQGLSVGGEYGTTATYMSEVALAGRRGFFSSFQYVTLIGGQL
LAVLVIVVLQFLLTSEQLHSWGWRIPFAIGGLAAIVALYLRRTLHETSTEKTRGNKAAGS
FSNIWKNHRKAFLVVVGFTAGGSLSFYTFTTYMQKYLVNTAGMSKETASETMTFVLLVFM
LMQPLFGALSDKVGRKTMMMGFGGISILTTIPLMTVIGSVQSSTWAFIYIVIALAVVSMY
TSVSGIVKAELFPAEVRALGVGFSYAIANALFGGTAEYVALWFKKQGMESGFFWYVTAIM
VVVFIVSLLMPNPREHGYLQGHGSDD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory