SitesBLAST
Comparing WP_005454544.1 NCBI__GCF_000244975.1:WP_005454544.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5c7sA Prpp complexed with two mn2+ in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
56% identity, 99% coverage: 5:341/341 of query aligns to 3:342/344 of 5c7sA
- active site: V83 (= V82)
- binding manganese (ii) ion: G84 (= G83), S96 (= S95), D228 (= D227), E229 (= E228), E229 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V83 (= V82), G84 (= G83), G86 (= G85), G87 (= G86), N94 (= N93), S96 (= S95), T97 (= T96), K112 (= K111), N115 (= N114), S120 (= S119)
5c1rA Stereoisomer of prpp bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyl (anprt; trpd)
56% identity, 99% coverage: 5:341/341 of query aligns to 2:341/343 of 5c1rA
- active site: V82 (= V82)
- binding 5-O-[(R)-hydroxy(phosphonooxy)phosphoryl]-1-O-phosphono-alpha-D-ribofuranose: V82 (= V82), G83 (= G83), G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), R115 (= R115), A117 (= A117), S118 (= S118), S119 (= S119)
- binding magnesium ion: D87 (= D87), V89 (≠ K89), S95 (= S95), E228 (= E228)
3r88B Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs145) (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 2:341/344 of 3r88B
- active site: V82 (= V82)
- binding 2-amino-4,5-dimethoxybenzoic acid: N114 (= N114), A155 (= A155), P156 (= P156), H159 (= H159), Y162 (= Y162), R163 (= R163), A166 (≠ G166)
- binding magnesium ion: S95 (= S95), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V82 (= V82), G83 (= G83), G85 (= G85), G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), N114 (= N114), A117 (= A117), S118 (= S118), S119 (= S119)
4zokA Methylsulfonyl-containing inhibitor bound in the substrate capture site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
57% identity, 99% coverage: 5:341/341 of query aligns to 2:340/342 of 4zokA
- active site: V82 (= V82)
- binding 4-methyl-2-{[2-methyl-6-(methylsulfonyl)phenyl]amino}benzoic acid: P156 (= P156), R163 (= R163), A166 (≠ G166), A167 (≠ P167)
- binding magnesium ion: S95 (= S95), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), A116 (= A116), A117 (= A117), S119 (= S119), G122 (= G122)
4zofA Lobenzarit-like inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
57% identity, 99% coverage: 5:341/341 of query aligns to 2:340/342 of 4zofA
- active site: V82 (= V82)
- binding 2-[(2-carboxy-5-nitrophenyl)amino]-3-methylbenzoic acid: G113 (= G113), N114 (= N114), A155 (= A155), H159 (= H159), Y162 (= Y162), R169 (= R169), G182 (= G182)
- binding magnesium ion: S95 (= S95), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G83), G85 (= G85), G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), A116 (= A116), A117 (= A117), S119 (= S119), G122 (= G122)
4n5vA Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 4:344/347 of 4n5vA
- active site: V84 (= V82)
- binding 2-amino-4-fluorobenzoic acid: V84 (= V82), G85 (= G83), H114 (= H112), G115 (= G113), N116 (= N114), A157 (= A155), A157 (= A155), P158 (= P156), H161 (= H159), Y164 (= Y162), R165 (= R163), A168 (≠ G166), R171 (= R169), G184 (= G182)
- binding magnesium ion: S97 (= S95), D229 (= D227), E230 (= E228), E230 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G85 (= G83), G87 (= G85), G88 (= G86), N95 (= N93), S97 (= S95), T98 (= T96), K113 (= K111), A119 (= A117), S120 (= S118), S121 (= S119), G124 (= G122)
4n93A Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 3:343/346 of 4n93A
- active site: V83 (= V82)
- binding 2-amino-6-methylbenzoic acid: V83 (= V82), G84 (= G83), T85 (= T84), H113 (= H112), N115 (= N114), N115 (= N114), A156 (= A155), P157 (= P156), H160 (= H159), Y163 (= Y162), A167 (≠ G166), R170 (= R169), G183 (= G182), P184 (= P183)
- binding magnesium ion: S96 (= S95), D228 (= D227), E229 (= E228), E229 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G83), G86 (= G85), G87 (= G86), N94 (= N93), S96 (= S95), T97 (= T96), K112 (= K111), A117 (= A116), A118 (= A117), S120 (= S119), G123 (= G122)
P9WFX5 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
56% identity, 99% coverage: 5:341/341 of query aligns to 26:367/370 of P9WFX5
- G107 (= G83) binding
- T115 (≠ S91) binding
- G147 (≠ A123) binding
5c2lA Magnesium soaked into the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
56% identity, 99% coverage: 5:341/341 of query aligns to 4:345/349 of 5c2lA
4owuA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 5-methylanthranilate, prpp and magnesium (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 3:344/347 of 4owuA
- active site: V83 (= V82)
- binding 2-azanyl-5-methyl-benzoic acid: N115 (= N114), P157 (= P156), Y163 (= Y162), R164 (= R163), A167 (≠ G166)
- binding magnesium ion: S96 (= S95), D228 (= D227), E229 (= E228), E229 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G83), G86 (= G85), G87 (= G86), N94 (= N93), S96 (= S95), T97 (= T96), K112 (= K111), A118 (= A117), S120 (= S119), G123 (= G122)
4owqA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-methylanthranilate, prpp and magnesium (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 3:344/347 of 4owqA
- active site: V83 (= V82)
- binding 2-azanyl-3-methyl-benzoic acid: P157 (= P156), H160 (= H159), Y163 (= Y162), A167 (≠ G166), R171 (= R170)
- binding magnesium ion: S96 (= S95), D228 (= D227), E229 (= E228), E229 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V83 (= V82), G84 (= G83), G86 (= G85), G87 (= G86), N94 (= N93), S96 (= S95), T97 (= T96), K112 (= K111), A117 (= A116), A118 (= A117), S120 (= S119), G123 (= G122)
4owoA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 6-fluoroanthranilate, prpp and magnesium (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 4:345/348 of 4owoA
- active site: V84 (= V82)
- binding 2-azanyl-6-fluoranyl-benzoic acid: V84 (= V82), G85 (= G83), T86 (= T84), H114 (= H112), N116 (= N114), N116 (= N114), A157 (= A155), P158 (= P156), H161 (= H159), Y164 (= Y162), A168 (≠ G166), R171 (= R169), G184 (= G182)
- binding magnesium ion: S97 (= S95), D229 (= D227), E230 (= E228), E230 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V84 (= V82), G85 (= G83), G87 (= G85), G88 (= G86), N95 (= N93), S97 (= S95), T98 (= T96), K113 (= K111), A118 (= A116), A119 (= A117), S120 (= S118), S121 (= S119), G124 (= G122)
4giuA Bianthranilate-like analogue bound in inner site of anthranilate phosphoribosyltransferase (anprt; trpd). (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 3:344/346 of 4giuA
- active site: V83 (= V82)
- binding 2-[(2-carboxy-5-methylphenyl)amino]-3-methylbenzoic acid: G114 (= G113), N115 (= N114), A156 (= A155), H160 (= H159), Y163 (= Y162), R170 (= R169), G183 (= G182)
- binding magnesium ion: S96 (= S95), D228 (= D227), E229 (= E228), E229 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G83), G86 (= G85), G87 (= G86), N94 (= N93), S96 (= S95), T97 (= T96), K112 (= K111), N115 (= N114), A117 (= A116), A118 (= A117), S119 (= S118), S120 (= S119), G123 (= G122)
4owmA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-fluoroanthranilate, prpp and magnesium (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 2:343/346 of 4owmA
- active site: V82 (= V82)
- binding 2-azanyl-3-fluoranyl-benzoic acid: P156 (= P156), H159 (= H159), Y162 (= Y162), R163 (= R163), A166 (≠ G166), R170 (= R170)
- binding magnesium ion: S95 (= S95), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G83), G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), A117 (= A117), S118 (= S118), S119 (= S119), G122 (= G122)
4gkmA Bianthranilate-like analogue bound in the outer site of anthranilate phosphoribosyltransferase (anprt; trpd) (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 2:343/346 of 4gkmA
- active site: V82 (= V82)
- binding 2-[(2-carboxyphenyl)amino]-5-methylbenzoic acid: N114 (= N114), A155 (= A155), P156 (= P156), Y162 (= Y162), R163 (= R163), A166 (≠ G166), R169 (= R169), R170 (= R170)
- binding magnesium ion: S95 (= S95), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), A117 (= A117), S118 (= S118), S119 (= S119), G122 (= G122)
3r6cA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs179) (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 2:343/346 of 3r6cA
- active site: V82 (= V82)
- binding 8-methoxyphenanthro[3,4-d][1,3]dioxole-5,6-dicarboxylic acid: M62 (= M65), N114 (= N114), A155 (= A155), P156 (= P156), H159 (= H159), Y162 (= Y162), A166 (≠ G166), R169 (= R169), G182 (= G182), T185 (= T185), R239 (≠ V239), A241 (≠ S241), D246 (≠ R246), V301 (≠ A301), A310 (vs. gap), W312 (≠ L310)
- binding magnesium ion: S95 (= S95), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G83), G85 (= G85), G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), N114 (= N114), R115 (= R115), A116 (= A116), A117 (= A117), S118 (= S118), S119 (= S119), G122 (= G122), G123 (≠ A123)
3qsaA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor tamu-a7)
56% identity, 99% coverage: 5:341/341 of query aligns to 2:343/346 of 3qsaA
- active site: V82 (= V82)
- binding magnesium ion: S95 (= S95), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G83), G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), A117 (= A117), S118 (= S118), S119 (= S119), G122 (= G122)
- binding 4,4,4-trifluoro-1-(4-methoxyphenyl)butane-1,3-dione: M62 (= M65), N114 (= N114), A155 (= A155), P156 (= P156), H159 (= H159), Y162 (= Y162), R163 (= R163), A166 (≠ G166), G182 (= G182)
3qs8A Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs174) (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 2:343/346 of 3qs8A
- active site: V82 (= V82)
- binding 2-benzylbenzoic acid: M62 (= M65), G83 (= G83), N114 (= N114), N114 (= N114), A155 (= A155), A155 (= A155), P156 (= P156), Y162 (= Y162), Y162 (= Y162), A166 (≠ G166), R169 (= R169), R169 (= R169), R170 (= R170), L181 (= L181), G182 (= G182)
- binding magnesium ion: S95 (= S95), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G83), G85 (= G85), G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), N114 (= N114), A116 (= A116), A117 (= A117), S118 (= S118), S119 (= S119), G122 (= G122), E228 (= E228)
3qqsA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs172) (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 2:343/346 of 3qqsA
- active site: V82 (= V82)
- binding 2,2'-iminodibenzoic acid: P156 (= P156), H159 (= H159), Y162 (= Y162), R163 (= R163), A166 (≠ G166), R169 (= R169), R170 (= R170)
- binding magnesium ion: S95 (= S95), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V82 (= V82), G85 (= G85), G86 (= G86), N93 (= N93), S95 (= S95), T96 (= T96), K111 (= K111), R115 (= R115), A117 (= A117), S118 (= S118), S119 (= S119), G122 (= G122)
1zvwA The crystal structure of trpd (rv2192c) from mycobacterium tuberculosis in complex with prpp and magnesium (see paper)
56% identity, 99% coverage: 5:341/341 of query aligns to 2:343/346 of 1zvwA
- active site: V82 (= V82)
- binding benzamidine: T46 (≠ R49), M47 (≠ A50), K48 (= K51), P50 (≠ E53), D201 (= D201)
- binding magnesium ion: S95 (= S95), D227 (= D227), E228 (= E228), E228 (= E228)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G83), N93 (= N93), S95 (= S95), T96 (= T96), A117 (= A117), S118 (= S118), S119 (= S119)
Query Sequence
>WP_005454544.1 NCBI__GCF_000244975.1:WP_005454544.1
MPEHTWPAVLNQLIERVDLSEDATAWAMDQVMSGEATPAQIAGFAVALRAKGETPAEISG
MAKAMLAHSKRIDLGTRTVDIVGTGGDRKGSVNISTMTSLVVAAAGTPVVKHGNRAASSK
SGAADVLEALGVTIESEPDDVRRCVEELGIGFCFAPVFHPAYRHTGPPRRELGVSTAFNL
LGPLTNPAQPSSGLIGCAYLDKAPVLAEVYARRGHSVLLVRGDDGFDEITTTTTSTAWVV
SNGQVRTTTIDPETLGIPLSTPDALRGGDAAANAEVVKELVGGKTGPVRDAVLLNAAGAL
AAFAGFSDDLTADLRAGLELATRAIDSGAAADLLTRWINRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory