Comparing WP_005455986.1 NCBI__GCF_000244975.1:WP_005455986.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
27% identity, 99% coverage: 7:440/440 of query aligns to 51:490/503 of Q8C165
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 94% coverage: 9:421/440 of query aligns to 7:378/407 of P37111
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 94% coverage: 9:421/440 of query aligns to 7:379/408 of Q03154
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
26% identity, 72% coverage: 20:334/440 of query aligns to 25:355/458 of 2pokA
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
33% identity, 37% coverage: 9:172/440 of query aligns to 1:158/192 of 1q7lA
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
23% identity, 97% coverage: 12:439/440 of query aligns to 7:377/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
23% identity, 97% coverage: 12:439/440 of query aligns to 3:373/377 of P44514
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
29% identity, 35% coverage: 12:167/440 of query aligns to 5:149/258 of 4h2kA
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
25% identity, 93% coverage: 32:439/440 of query aligns to 16:373/377 of 7t1qA
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
27% identity, 38% coverage: 7:173/440 of query aligns to 11:184/475 of Q96KP4
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
26% identity, 53% coverage: 13:245/440 of query aligns to 4:228/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
26% identity, 53% coverage: 13:245/440 of query aligns to 4:228/376 of 4o23A
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
24% identity, 39% coverage: 5:174/440 of query aligns to 9:186/475 of Q9D1A2
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
24% identity, 39% coverage: 5:174/440 of query aligns to 13:190/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
24% identity, 39% coverage: 5:174/440 of query aligns to 13:190/478 of 2zofA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
32% identity, 27% coverage: 12:131/440 of query aligns to 8:120/383 of 7uoiA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 33% coverage: 74:219/440 of query aligns to 90:221/426 of 3pfoA
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
27% identity, 39% coverage: 7:176/440 of query aligns to 13:190/471 of 3dljA
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
28% identity, 53% coverage: 15:245/440 of query aligns to 8:229/377 of 7lgpB
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
27% identity, 43% coverage: 7:197/440 of query aligns to 42:241/507 of Q96KN2
Sites not aligning to the query:
>WP_005455986.1 NCBI__GCF_000244975.1:WP_005455986.1
MTEPNLIDEAADEAVTLTSELIRIDTTNTGDPATLAGEREAAEYVAEKLTEVGYEITYVE
SGAKSRHNVIARLAGADPSRGALLVHGHLDVVPADPSEWSVHPFSGAVQDGYVWGRGAVD
MKDMVGMSLALARHYKRHGIVPPRDIIFAFLADEEAGSQYGAQWLVEHRPELFEGATEAI
SEVGGFSITLRDNVRAYLIETAEKGIRWMTLRVRGTAGHGSMLHHDNAVTKLSEAVARLG
NHRFPLVLTDSVREFLAGVTEITGWDFPEDDIEGAVAKLGNISRMIGATLRDTANPTMLN
AGYKANVIPSTAEATVDCRILPGRVEAFNRELDEILGPDIEKEWLELPPVETTFDGALVD
AMSAAVLAEDPGARTLPYMLSGGTDAKAFQKLGIRNFGFAPLKLPDDLDFSALFHGVDER
VPVDALKFGTRVLDRFFRNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory