SitesBLAST
Comparing WP_005456797.1 NCBI__GCF_000244975.1:WP_005456797.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d1cA Crystal structure of tt0538 protein from thermus thermophilus hb8
46% identity, 98% coverage: 10:481/481 of query aligns to 21:494/495 of 2d1cA
- active site: Y143 (= Y131), K190 (= K178), D223 (= D211), D247 (= D235), D251 (= D239)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P86 (= P75), L87 (≠ I76), E88 (≠ T77), T89 (= T78), N99 (= N88), I221 (= I209), N224 (≠ I212), Q228 (≠ K216), L260 (≠ V248), G261 (= G249), H279 (= H267), G280 (= G268), S281 (= S269), A282 (= A270), K284 (≠ R272), Y285 (≠ R273), I291 (≠ A279), N292 (= N280), D333 (= D320)
6lkyA Crystal structure of isocitrate dehydrogenase from methylococcus capsulatus
44% identity, 70% coverage: 10:346/481 of query aligns to 4:339/339 of 6lkyA
- active site: Y123 (= Y131), K174 (= K178), D207 (= D211), D231 (= D235)
- binding nicotinamide-adenine-dinucleotide: P68 (= P75), L69 (≠ I76), T71 (= T78), N81 (= N88), H263 (= H267), G264 (= G268), S265 (= S269), A266 (= A270), D268 (≠ R272), I269 (≠ R273), N276 (= N280)
6m3sB Dimeric isocitrate dehydrogenase from xanthomonas campestris pv. Campestris 8004
45% identity, 71% coverage: 4:344/481 of query aligns to 2:338/338 of 6m3sB
- active site: Y128 (= Y131), K177 (= K178), D210 (= D211), D234 (= D235)
- binding isocitrate calcium complex: T75 (= T78), S83 (= S86), N85 (= N88), R89 (= R92), R99 (= R102), R121 (= R124), Y128 (= Y131), D234 (= D235), D238 (= D239)
- binding nicotinamide-adenine-dinucleotide: P72 (= P75), L73 (≠ I76), T75 (= T78), N85 (= N88), H266 (= H267), G267 (= G268), S268 (= S269), A269 (= A270), D271 (≠ R272), I272 (≠ R273), N279 (= N280)
Q9D6R2 Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; Isocitric dehydrogenase subunit alpha; NAD(+)-specific ICDH subunit alpha; EC 1.1.1.41 from Mus musculus (Mouse) (see paper)
44% identity, 64% coverage: 10:315/481 of query aligns to 34:338/366 of Q9D6R2
- E229 (≠ H207) mutation to K: Homozygous mutant mice exhibit retinal degeneration.
3blwF Yeast isocitrate dehydrogenase with citrate and amp bound in the regulatory subunits (see paper)
43% identity, 70% coverage: 10:344/481 of query aligns to 21:347/347 of 3blwF
6kdyA Crystal structure of the alpha bata heterodimer of human idh3 in complex with NAD. (see paper)
44% identity, 64% coverage: 10:315/481 of query aligns to 5:309/335 of 6kdyA
- active site: Y124 (= Y131), K171 (= K178), D204 (= D211), D228 (= D235)
- binding nicotinamide-adenine-dinucleotide: P69 (= P75), L70 (≠ I76), T72 (= T78), N82 (= N88), H261 (= H267), G262 (= G268), T263 (≠ S269), A264 (= A270), D266 (≠ R272), I267 (≠ R273), N274 (= N280)
Sites not aligning to the query:
6kdeA Crystal structure of the alpha beta heterodimer of human idh3 in complex with ca(2+) (see paper)
44% identity, 64% coverage: 10:315/481 of query aligns to 5:309/336 of 6kdeA
P50213 Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; Isocitric dehydrogenase subunit alpha; NAD(+)-specific ICDH subunit alpha; EC 1.1.1.41 from Homo sapiens (Human) (see 5 papers)
44% identity, 64% coverage: 10:315/481 of query aligns to 34:338/366 of P50213
- R115 (= R92) binding
- A122 (= A99) to T: in RP90; uncertain significance; dbSNP:rs756333430
- R125 (= R102) binding
- R146 (= R124) binding
- E152 (≠ L130) mutation to A: No significant effect on the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- Y153 (= Y131) Critical for catalysis; mutation to F: Complete loss of activity of the heterotetramer, heterodimer composed of IDH3A and IDH3B subunits and the heterodimer composed of IDH3A and IDH3G subunits with no effect on their oligomeric states.
- K169 (= K147) mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- A175 (≠ G153) to V: in RP90; uncertain significance; dbSNP:rs765473830
- K200 (= K178) Critical for catalysis; mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- N202 (= N180) mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- M204 (= M182) to I: in RP90; uncertain significance
- D208 (= D186) mutation to A: Complete loss of the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- D233 (= D211) binding
- M239 (≠ L217) to T: in RP90; uncertain significance; dbSNP:rs2074707744
- Y255 (= Y233) mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- D257 (= D235) binding
- D261 (= D239) binding
- P304 (= P281) to H: in RP90; uncertain significance; dbSNP:rs756712426
- M313 (≠ Q290) to T: in RP90; uncertain significance; dbSNP:rs149862950
- R316 (≠ V293) to C: in RP90; uncertain significance; dbSNP:rs770798851
5yvtA Crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+) and nadh (see paper)
44% identity, 64% coverage: 10:315/481 of query aligns to 4:306/332 of 5yvtA
- active site: Y121 (= Y131), K168 (= K178), D201 (= D211), D225 (= D235), D229 (= D239)
- binding magnesium ion: D225 (= D235), D229 (= D239)
- binding 1,4-dihydronicotinamide adenine dinucleotide: L69 (≠ I76), T71 (= T78), N79 (= N88), N170 (= N180), D201 (= D211), E255 (= E264), V257 (≠ I266), H258 (= H267), G259 (= G268), I264 (≠ R273), N271 (= N280)
Sites not aligning to the query:
6l59A Crystal structure of the alpha gamma heterodimer of human idh3 in complex with cit, mg and atp binding at allosteric site and mg, atp binding at active site. (see paper)
43% identity, 64% coverage: 10:315/481 of query aligns to 4:297/325 of 6l59A
Sites not aligning to the query:
5greA Crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+), citrate and adp (see paper)
43% identity, 64% coverage: 10:315/481 of query aligns to 4:298/325 of 5greA
8grdA Crystal structure of a constitutively active mutant of the alpha beta heterodimer of human idh3 in complex with adp and mg (see paper)
44% identity, 64% coverage: 10:315/481 of query aligns to 4:299/325 of 8grdA
3blvC Yeast isocitrate dehydrogenase with citrate bound in the regulatory subunits (see paper)
37% identity, 70% coverage: 10:344/481 of query aligns to 20:341/344 of 3blvC
3blwA Yeast isocitrate dehydrogenase with citrate and amp bound in the regulatory subunits (see paper)
37% identity, 70% coverage: 10:344/481 of query aligns to 5:326/329 of 3blwA
- active site: F116 (≠ Y131), K163 (= K178), D197 (= D211), T221 (≠ D235), N225 (≠ D239)
- binding adenosine monophosphate: G257 (≠ A270), N267 (= N280), D308 (≠ I321)
- binding citrate anion: T63 (= T78), S72 (= S86), N74 (= N88), V75 (= V89), R78 (= R92), R109 (= R124), F116 (≠ Y131), T221 (≠ D235), R254 (vs. gap)
2iv0A Thermal stability of isocitrate dehydrogenase from archaeoglobus fulgidus studied by crystal structure analysis and engineering of chimers (see paper)
36% identity, 70% coverage: 10:344/481 of query aligns to 30:409/412 of 2iv0A
6l57B Crystal structure of the alpha gamma heterodimer of human idh3 in complex with cit , mg and atp binding at allosteric site. (see paper)
39% identity, 65% coverage: 10:321/481 of query aligns to 4:313/332 of 6l57B
- active site: Y121 (= Y131), K168 (= K178), D201 (= D211), N225 (≠ D235)
- binding adenosine-5'-triphosphate: I12 (= I18), P238 (≠ V248), N259 (≠ G268), T260 (≠ S269), G261 (≠ A270), K262 (≠ P271), S263 (≠ R272), I264 (≠ R273), N271 (= N280), D312 (= D320)
- binding magnesium ion: N64 (≠ P75), R258 (≠ H267)
5yvtB Crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+) and nadh (see paper)
39% identity, 65% coverage: 10:321/481 of query aligns to 4:313/333 of 5yvtB
- active site: Y121 (= Y131), K168 (= K178), D201 (= D211), N225 (≠ D235), N229 (≠ D239)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I12 (= I18), E66 (≠ T77), T67 (= T78), P238 (≠ V248), G239 (= G249), R258 (≠ H267), N259 (≠ G268), T260 (≠ S269), G261 (≠ A270), S263 (≠ R272), I264 (≠ R273), A270 (= A279), N271 (= N280), D312 (= D320)
P51553 Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial; Isocitric dehydrogenase subunit gamma; NAD(+)-specific ICDH subunit gamma from Homo sapiens (Human) (see 2 papers)
39% identity, 65% coverage: 10:321/481 of query aligns to 57:366/393 of P51553
- N117 (≠ P75) mutation to A: No effect on the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- T120 (= T78) binding ; mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- S130 (= S86) mutation to A: No significant effect on the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- N133 (≠ V89) binding ; mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- R136 (= R92) binding ; mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- R167 (= R124) binding ; mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- E173 (≠ L130) mutation to A: No effect on the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- Y174 (= Y131) mutation to F: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- K190 (= K147) mutation to A: Complete loss of the activation of the heterotetramer and the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- D229 (= D186) mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- D254 (= D211) binding ; binding
- Y276 (= Y233) mutation to F: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate and ADP.
- R311 (≠ H267) mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by citrate.
- N312 (≠ G268) binding ; mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by ADP.
- T313 (≠ S269) binding ; mutation to A: Significantly impairs the activation of the heterodimer composed of IDH3A and IDH3G subunits by ADP.
- K315 (≠ P271) mutation to A: No significant effect on the activation of the heterodimer composed of IDH3A and IDH3G subunits by ADP.
- N324 (= N280) binding ; mutation to A: Complete loss of the activation of the heterodimer composed of IDH3A and IDH3G subunits by ADP.
5grfB Crystal structure of the alpha gamma mutant (gamma-k151a) of human idh3 in complex with mg(2+), citrate and adp (see paper)
38% identity, 65% coverage: 10:321/481 of query aligns to 4:313/335 of 5grfB
- active site: Y121 (= Y131), K168 (= K178), D201 (= D211), N225 (≠ D235), N229 (≠ D239)
- binding adenosine-5'-diphosphate: I12 (= I18), P238 (≠ V248), N259 (≠ G268), T260 (≠ S269), G261 (≠ A270), K262 (≠ P271), I264 (≠ R273), N271 (= N280), D312 (= D320)
- binding magnesium ion: N64 (≠ P75), R258 (≠ H267)
6kdyF Crystal structure of the alpha bata heterodimer of human idh3 in complex with NAD. (see paper)
37% identity, 60% coverage: 7:296/481 of query aligns to 1:290/341 of 6kdyF
Query Sequence
>WP_005456797.1 NCBI__GCF_000244975.1:WP_005456797.1
MTTHSTSAPITVAHGDGIGPEIMEATLSVLNAAGAALDIDTITIGESVYQAGNPAGVTPE
ALESIRRTGVFLKAPITTPQGGGFKSLNVTVRKTFGLYANVRPCVAYAPFVATKHPGMDV
VIVRENEEDLYAGIEHRQTDEVVQCLKLISRQGCERVIRYAFEYATAYRRTKVTAFTKDN
IMKMTDGLFHRVFDEVAADYPDIQAEHWIVDIGAAKLADTPEAFDVVVLPNLYGDILSDV
AAQIAGSVGLAGSANIGERVAMFEAIHGSAPRRAGQDVANPSGLLLAAVQMLVHIGQADV
ASRVHNAWLRTIEDGIHTYDIYEPDTSTSKVGTTAFAASVIDRLGQEPTRLPATHYAQHR
PITVKLAGRSAAAKTQLGVDVFVHSPDTTPDELAAKLRPFAAPLHLDMISNRGQKVWPGG
APETLLTDHWRCRFLDPRGTTTAAEVVALQARMVEHGIEPIKTEGLYAFDGEPAFTRGQG
Q
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory