Comparing WP_005457740.1 NCBI__GCF_000244975.1:WP_005457740.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1kflA Crystal structure of phenylalanine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase (dahp synthase) from e.Coli complexed with mn2+, pep, and phe (see paper)
54% identity, 93% coverage: 22:368/374 of query aligns to 6:349/350 of 1kflA
P0AB91 Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive; 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase; DAHP synthase; Phospho-2-keto-3-deoxyheptonate aldolase; EC 2.5.1.54 from Escherichia coli (strain K12) (see paper)
54% identity, 93% coverage: 22:368/374 of query aligns to 6:349/350 of P0AB91
5cksB Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime. (see paper)
54% identity, 93% coverage: 22:368/374 of query aligns to 1:344/345 of 5cksB
8e0sD Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:unbound conformations (see paper)
54% identity, 92% coverage: 25:368/374 of query aligns to 3:343/343 of 8e0sD
7rudB Dahp synthase complex with trifluoropyruvate oxime (see paper)
54% identity, 92% coverage: 25:368/374 of query aligns to 3:343/343 of 7rudB
1gg1A Crystal structure analysis of dahp synthase in complex with mn2+ and 2-phosphoglycolate (see paper)
53% identity, 92% coverage: 25:368/374 of query aligns to 3:339/339 of 1gg1A
1qr7A Crystal structure of phenylalanine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from escherichia coli complexed with pb2+ and pep (see paper)
53% identity, 92% coverage: 25:368/374 of query aligns to 2:337/338 of 1qr7A
7rueA Dahp synthase complexed with trifluoropyruvate semicarbazone (see paper)
53% identity, 93% coverage: 22:368/374 of query aligns to 2:339/339 of 7rueA
5cksA Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime. (see paper)
53% identity, 93% coverage: 22:368/374 of query aligns to 2:338/339 of 5cksA
4hsoA Crystal structure of s213g variant dah7ps from neisseria meningitidis (see paper)
51% identity, 93% coverage: 22:370/374 of query aligns to 3:344/345 of 4hsoA
1ofoA Crystal structure of the tyrosine regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae in complex with 2-phosphoglycolate (see paper)
52% identity, 91% coverage: 31:369/374 of query aligns to 9:341/344 of 1ofoA
1of8A Double complex of the tyrosine sensitive dahp synthase from s. Cerevisiae with co2+, pep and the e4p analogoue g3p (see paper)
52% identity, 91% coverage: 31:369/374 of query aligns to 8:337/339 of 1of8A
5dceA Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated (tryptophan) (see paper)
50% identity, 93% coverage: 22:370/374 of query aligns to 3:344/344 of 5dceA
5dcbC Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated and complexed with pep
50% identity, 93% coverage: 22:370/374 of query aligns to 7:348/348 of 5dcbC
5dcdA Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated (tyrosine)
50% identity, 93% coverage: 22:370/374 of query aligns to 5:346/346 of 5dcdA
1hfbA Crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phosphoenolpyruvate (see paper)
51% identity, 91% coverage: 31:369/374 of query aligns to 8:336/339 of 1hfbA
8e0sA Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:unbound conformations (see paper)
53% identity, 92% coverage: 25:368/374 of query aligns to 3:335/336 of 8e0sA
7reuB Crystal structure of aro4p, 3-deoxy-d-arabino-heptulosonate-7- phosphate (dahp) synthase from candida auris, l-tyr complex
46% identity, 94% coverage: 22:372/374 of query aligns to 4:358/358 of 7reuB
1of6A Crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with tyrosine and manganese
51% identity, 91% coverage: 31:369/374 of query aligns to 13:348/350 of 1of6A
Sites not aligning to the query:
3tqkA Structure of phospho-2-dehydro-3-deoxyheptonate aldolase from francisella tularensis schu s4 (see paper)
49% identity, 90% coverage: 32:368/374 of query aligns to 8:340/341 of 3tqkA
>WP_005457740.1 NCBI__GCF_000244975.1:WP_005457740.1
MPDDAPSATSVTTDTDPLTTLDNRRTTRVSPLLSPALLRAEYPITPGVAKTVTLGRRDTV
DILDGRDDRLLVVVGPCSVHDPEAALHYARLLSAHAETVRDEVCVVMRVYFEKPRTTLGW
KGLINDPDLDGTYAVNKGLRLARRLLLDISALGLPVGSEFLDPITPQYIADTVTWGSIGA
RTAASQVHRQLCSALSMPVGIKNSTEGDVQVAVDAVRAAAASHVFPGINADGLAALVTTS
GNPDCHVILRGGSAGPNYDAETVADTLARLRGAGLPERVIVDASHGNSRKDHVRQAAVVR
ELAGRIAAGEPGIAGLMMESFLEAGRQELTLGRREELDYGRSITDACLDWTTTAGLLDEL
AAAVRERRRRRGNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory