Comparing WP_005458424.1 NCBI__GCF_000244975.1:WP_005458424.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
51% identity, 96% coverage: 21:532/534 of query aligns to 30:544/554 of P30952
Sites not aligning to the query:
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
53% identity, 97% coverage: 8:526/534 of query aligns to 1:498/501 of 3cuxA
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
48% identity, 98% coverage: 4:526/534 of query aligns to 2:525/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
48% identity, 98% coverage: 4:526/534 of query aligns to 2:525/529 of 3cuzA
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
49% identity, 96% coverage: 14:526/534 of query aligns to 7:520/524 of 3cv2A
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
24% identity, 58% coverage: 179:490/534 of query aligns to 357:678/729 of 6axeA
Sites not aligning to the query:
>WP_005458424.1 NCBI__GCF_000244975.1:WP_005458424.1
MADTMNGRLRVAGPMRERYDEILTPAALEFVAKLDNAFAGRRRELLDARRLRRERLASGE
ETLGFLPETRWIRGDESWQVAQPAPGLEDRRVEITGPPEKKMTVNALNSGAKVWLADFED
ATSPTWHNIVSGQLNLYDAIRRDIDFTDRGKRYVIGEEPATIVARPRGWHLVEKHVRIDG
RPVSASLVDFGLYFFHNARQLLARGSGPYFYLPKLESHHEARLWNDVFRFAQDELGIPRG
TIRATVLIETITAAFEMDEILYELREHAAGLNAGRWDYIFSIIKTFASHGADYVLPDRVQ
VTMTVPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRDPEVNATALEKVRQDKEREAGDG
FDGSWVAHPGLVPVCREAFDEVLGGWPNQLGRLREDVVVTAEDLLNVASAGGEVTEQGVR
SNINVALRYVDAWLRGTGAAAIFGLMEDAATAEIARCQVWQWVRNGTKLADGTAITPERV
MDWLDAELAGVHAELGEGNRLTEAREILVETALSEKLPSFFTTGAYARYLTTPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory