SitesBLAST
Comparing WP_006746632.1 NCBI__GCF_000227685.2:WP_006746632.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
54% identity, 97% coverage: 5:329/335 of query aligns to 6:330/336 of 5z20F
- active site: S108 (= S107), R241 (= R240), D265 (= D264), E270 (= E269), H302 (= H301)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y106), G160 (= G159), Q161 (≠ R160), I162 (= I161), Y180 (≠ F179), D181 (= D180), P182 (= P181), C212 (= C211), P213 (= P212), T218 (= T217), T239 (= T238), G240 (≠ S239), R241 (= R240), H302 (= H301), A304 (≠ G303)
4cukA Structure of salmonella d-lactate dehydrogenase in complex with nadh
52% identity, 98% coverage: 8:335/335 of query aligns to 2:329/330 of 4cukA
- active site: S101 (= S107), R234 (= R240), D258 (= D264), E263 (= E269), H295 (= H301)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y106), G153 (= G159), K154 (≠ R160), I155 (= I161), F173 (= F179), D174 (= D180), P175 (= P181), H204 (= H210), C205 (= C211), P206 (= P212), N211 (≠ T217), T232 (= T238), Y260 (= Y266), H295 (= H301), A297 (≠ G303)
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
47% identity, 98% coverage: 8:334/335 of query aligns to 12:344/346 of 4zgsA
- active site: S111 (= S107), R244 (= R240), D268 (= D264), E273 (= E269), H311 (= H301)
- binding nicotinamide-adenine-dinucleotide: Y110 (= Y106), G163 (= G159), A164 (≠ R160), I165 (= I161), D184 (= D180), C215 (= C211), P216 (= P212), L218 (≠ T214), S220 (≠ E216), T221 (= T217), S243 (= S239), H311 (= H301), F314 (= F304)
5z21B The ternary structure of d-lactate dehydrogenase from fusobacterium nucleatum with nadh and oxamate (see paper)
43% identity, 98% coverage: 6:334/335 of query aligns to 1:329/331 of 5z21B
- active site: S101 (= S107), R235 (= R240), D259 (= D264), E264 (= E269), H296 (= H301)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y106), I105 (≠ V111), G153 (= G159), K154 (≠ R160), I155 (= I161), D174 (= D180), L175 (≠ P181), P207 (= P212), T212 (= T217), T233 (= T238), G234 (≠ S239), R235 (= R240), H296 (= H301), Y299 (≠ F304)
8grvA Dictyostelium discoideum lactate dehydrogenase (dicldha)with NAD
42% identity, 94% coverage: 8:321/335 of query aligns to 4:318/336 of 8grvA
- binding nicotinamide-adenine-dinucleotide: V106 (= V111), G154 (= G159), N155 (≠ R160), I156 (= I161), D176 (= D180), I177 (≠ P181), I178 (≠ Y182), T208 (≠ C211), P209 (= P212), T214 (= T217), V235 (≠ T238), H298 (= H301), A300 (≠ G303), W301 (≠ F304)
2dldA D-lactate dehydrogenase complexed with nadh and oxamate
34% identity, 96% coverage: 7:329/335 of query aligns to 2:326/337 of 2dldA
- active site: S103 (= S107), R236 (= R240), D260 (= D264), E265 (= E269), H297 (= H301)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T154 (= T158), G155 (= G159), H156 (≠ R160), I157 (= I161), D176 (= D180), I177 (≠ P181), V207 (≠ C211), P208 (= P212), N213 (≠ T217), C234 (≠ T238), S235 (= S239), H297 (= H301)
Sites not aligning to the query:
P30901 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus helveticus (Lactobacillus suntoryeus) (see paper)
34% identity, 96% coverage: 7:329/335 of query aligns to 2:326/337 of P30901
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P26297 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14) (see 2 papers)
34% identity, 94% coverage: 7:320/335 of query aligns to 2:316/333 of P26297
- HI 156:157 (≠ RI 160:161) binding
- D176 (= D180) binding
- H206 (= H210) mutation to Q: Increase of activity.
- VP 207:208 (≠ CP 211:212) binding
- N213 (≠ T217) binding
- R236 (= R240) mutation to K: Decrease of activity.
- D260 (= D264) binding ; mutation to N: Decrease of activity.
- E265 (= E269) mutation to Q: Decrease of activity.
- H297 (= H301) mutation to Q: 90% loss of activity.
1j49A Insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus (see paper)
34% identity, 94% coverage: 7:320/335 of query aligns to 2:316/332 of 1j49A
- active site: S103 (= S107), R236 (= R240), D260 (= D264), E265 (= E269), H297 (= H301)
- binding nicotinamide-adenine-dinucleotide: Y102 (= Y106), I107 (≠ V111), G153 (= G157), G155 (= G159), I157 (= I161), Y175 (≠ F179), D176 (= D180), I177 (≠ P181), V207 (≠ C211), P208 (= P212), N213 (≠ T217), V234 (≠ T238), S235 (= S239), R236 (= R240), H297 (= H301), A299 (≠ G303), F300 (= F304)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
36% identity, 89% coverage: 21:319/335 of query aligns to 15:312/334 of 3kb6B
- active site: S97 (= S107), R231 (= R240), D255 (= D264), E260 (= E269), H294 (= H301)
- binding lactic acid: F49 (= F57), S72 (≠ C82), V73 (≠ A83), G74 (= G84), Y96 (= Y106), R231 (= R240), H294 (= H301)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ A83), Y96 (= Y106), V101 (= V111), G150 (= G159), R151 (= R160), I152 (= I161), D171 (= D180), V172 (≠ P181), P203 (= P212), T229 (= T238), A230 (≠ S239), R231 (= R240), H294 (= H301), A296 (≠ G303), Y297 (≠ F304)
1dxyA Structure of d-2-hydroxyisocaproate dehydrogenase (see paper)
30% identity, 90% coverage: 21:321/335 of query aligns to 15:315/330 of 1dxyA
- active site: S101 (= S107), R234 (= R240), D258 (= D264), E263 (= E269), H295 (= H301)
- binding 2-oxo-4-methylpentanoic acid: V77 (≠ A83), Y100 (= Y106), Y298 (≠ F304)
- binding nicotinamide-adenine-dinucleotide: Y100 (= Y106), G152 (= G157), G154 (= G159), H155 (≠ R160), I156 (= I161), Y174 (≠ F179), D175 (= D180), P176 (= P181), H204 (= H210), V205 (≠ C211), P206 (= P212), N211 (≠ T217), T232 (= T238), A233 (≠ S239), R234 (= R240), H295 (= H301), Y298 (≠ F304)
P17584 D-2-hydroxyisocaproate dehydrogenase; D-HICDH; EC 1.1.1.- from Lacticaseibacillus paracasei (Lactobacillus paracasei) (see paper)
30% identity, 90% coverage: 21:321/335 of query aligns to 15:315/333 of P17584
4prlA Crystal structure of d-lactate dehydrogenase with NAD+ from lactobacillus jensenii (see paper)
31% identity, 96% coverage: 8:328/335 of query aligns to 2:322/330 of 4prlA
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y106), I106 (≠ V111), V154 (≠ T158), G155 (= G159), H156 (≠ R160), I157 (= I161), Y175 (≠ F179), D176 (= D180), H205 (= H210), T206 (≠ C211), P207 (= P212), A233 (≠ T238), A234 (≠ S239), D259 (= D264), H295 (= H301), A297 (≠ G303)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
34% identity, 83% coverage: 52:328/335 of query aligns to 47:315/334 of 5aovA
- active site: L100 (≠ S107), R241 (= R240), D265 (= D264), E270 (= E269), H288 (= H301)
- binding glyoxylic acid: M52 (≠ F57), L53 (≠ V58), L53 (≠ V58), Y74 (≠ R81), A75 (≠ C82), V76 (≠ A83), G77 (= G84), R241 (= R240), H288 (= H301)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A83), T104 (≠ V111), F158 (≠ T158), G159 (= G159), R160 (= R160), I161 (= I161), S180 (≠ D180), R181 (≠ P181), A211 (≠ H210), V212 (≠ C211), P213 (= P212), T218 (= T217), I239 (≠ T238), A240 (≠ S239), R241 (= R240), H288 (= H301), G290 (= G303)
2yq5C Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. Bulgaricus: NAD complexed form (see paper)
31% identity, 92% coverage: 8:315/335 of query aligns to 2:311/331 of 2yq5C
- active site: S102 (= S107), R236 (= R240), D260 (= D264), E265 (= E269), H297 (= H301)
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y106), I106 (≠ V111), V155 (≠ T158), G156 (= G159), H157 (≠ R160), I158 (= I161), Y176 (≠ F179), D177 (= D180), V178 (≠ P181), H206 (= H210), T207 (≠ C211), P208 (= P212), A235 (≠ S239), R236 (= R240), H297 (= H301), F300 (= F304)
4xkjA A novel d-lactate dehydrogenase from sporolactobacillus sp
33% identity, 94% coverage: 8:321/335 of query aligns to 2:315/332 of 4xkjA
- active site: S102 (= S107), R234 (= R240), D258 (= D264), E263 (= E269), H295 (= H301)
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y106), V106 (= V111), G152 (= G157), G154 (= G159), R155 (= R160), I156 (= I161), D175 (= D180), I176 (≠ P181), R179 (≠ D184), H204 (= H210), V205 (≠ C211), P206 (= P212), T211 (= T217), A232 (≠ T238), R234 (= R240), H295 (= H301), G297 (= G303), F298 (= F304)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
35% identity, 86% coverage: 42:328/335 of query aligns to 34:314/332 of 6biiA
- active site: L99 (≠ S107), R240 (= R240), D264 (= D264), E269 (= E269), H287 (= H301)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ A83), T103 (≠ V111), G156 (= G157), F157 (≠ T158), G158 (= G159), R159 (= R160), I160 (= I161), A179 (≠ D180), R180 (≠ P181), S181 (≠ Y182), K183 (≠ D184), V211 (≠ C211), P212 (= P212), E216 (= E216), T217 (= T217), V238 (≠ T238), A239 (≠ S239), R240 (= R240), D264 (= D264), H287 (= H301), G289 (= G303)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
34% identity, 89% coverage: 24:322/335 of query aligns to 15:303/304 of 1wwkA
- active site: S96 (= S107), R230 (= R240), D254 (= D264), E259 (= E269), H278 (= H301)
- binding nicotinamide-adenine-dinucleotide: V100 (= V111), G146 (= G157), F147 (≠ T158), G148 (= G159), R149 (= R160), I150 (= I161), Y168 (≠ F179), D169 (= D180), P170 (= P181), V201 (≠ C211), P202 (= P212), T207 (= T217), T228 (= T238), S229 (= S239), D254 (= D264), H278 (= H301), G280 (= G303)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
33% identity, 81% coverage: 51:321/335 of query aligns to 43:298/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
33% identity, 81% coverage: 51:321/335 of query aligns to 42:297/526 of 3dc2A
Sites not aligning to the query:
Query Sequence
>WP_006746632.1 NCBI__GCF_000227685.2:WP_006746632.1
MSDSRECRVAVFSTQKYDRLFLTQAATDSNVQFHFLEPRLEPDTVVLAQGANAICAFVND
RLDREVLTALKDAGIDLVALRCAGFNNVDLKAAEEIGVRVARVPAYSPNAVAEHAAALIM
TLNRKTHRAFNRVREGNFLLDGLMGFDVNGCTVGIVGTGRIGRSFARIMQGFGCEIVAFD
PYPDPEVEEMGIEYLPWEGFLNRSDIISLHCPLTPETHAMVDEKAISLMKPGVMLINTSR
GAIVDTHAVIDGLKSGRIGSLGLDVYEQEENLFFKDLSEEVIQDDVFQRLLTFPNVLITG
HQGFLTRQAMEEIARTTVENLSCLANDEPCLNRLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory