SitesBLAST
Comparing WP_007473232.1 NCBI__GCF_000170735.1:WP_007473232.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P23893 Glutamate-1-semialdehyde 2,1-aminomutase; GSA; Glutamate-1-semialdehyde aminotransferase; GSA-AT; EC 5.4.3.8 from Escherichia coli (strain K12) (see paper)
51% identity, 100% coverage: 3:420/420 of query aligns to 7:426/426 of P23893
- K265 (= K259) mutation to R: 2% of wild-type activity.
5i92F Crystal structure of glutamate-1-semialdehyde 2,1- aminomutase (gsa) from pseudomonas aeruginosa
53% identity, 98% coverage: 3:415/420 of query aligns to 7:416/420 of 5i92F
Sites not aligning to the query:
3bs8A Crystal structure of glutamate 1-semialdehyde aminotransferase complexed with pyridoxamine-5'-phosphate from bacillus subtilis (see paper)
52% identity, 99% coverage: 4:420/420 of query aligns to 11:427/430 of 3bs8A
- active site: V22 (= V15), Y145 (= Y138), E207 (= E198), D240 (= D231), M243 (= M234), K268 (= K259), G401 (≠ T394)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G111), T119 (= T112), Y145 (= Y138), H146 (= H139), E207 (= E198), N212 (= N203), D240 (= D231), V242 (= V233), K268 (= K259)
2e7uA Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from thermus thermophilus hb8
49% identity, 99% coverage: 4:417/420 of query aligns to 10:424/424 of 2e7uA
- active site: V21 (= V15), Y144 (= Y138), E206 (= E198), D238 (= D231), M241 (= M234), K266 (= K259), A401 (≠ T394)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G111), T118 (= T112), Y144 (= Y138), H145 (= H139), N211 (= N203), D238 (= D231), V240 (= V233)
6w80A Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from stenotrophomonas maltophilia k279a in complex with plp
48% identity, 97% coverage: 3:410/420 of query aligns to 14:419/430 of 6w80A
- active site: V26 (= V15), Y149 (= Y138), D241 (= D231), K269 (= K259)
- binding pyridoxal-5'-phosphate: S121 (= S110), G122 (= G111), T123 (= T112), Y149 (= Y138), H150 (= H139), E208 (= E198), N213 (= N203), D241 (= D231), V243 (= V233), K269 (= K259)
Q42522 Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic; GSA 2; Glutamate-1-semialdehyde aminotransferase 2; GSA-AT 2; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
48% identity, 99% coverage: 4:420/420 of query aligns to 55:472/472 of Q42522
- R92 (≠ F41) mutation to K: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with S-162.
- G162 (= G111) mutation to S: In gsa2-1; suppression of enf1 mutant pleiotropic developmental phenotypes; when associated with K-92.
P42799 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic; AtGSA1; GSA 1; Glutamate-1-semialdehyde aminotransferase 1; GSA-AT 1; EC 5.4.3.8 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
48% identity, 99% coverage: 4:420/420 of query aligns to 57:474/474 of P42799
- K314 (= K259) modified: N6-(pyridoxal phosphate)lysine
5hdmB Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
48% identity, 99% coverage: 4:420/420 of query aligns to 11:428/428 of 5hdmB
- active site: V22 (= V15), Y145 (= Y138), E207 (= E198), D240 (= D231), M243 (= M234), K268 (= K259), A402 (≠ T394)
- binding pyridoxal-5'-phosphate: G118 (= G111), T119 (= T112), Y145 (= Y138), E207 (= E198), N212 (= N203), D240 (= D231), V242 (= V233), M243 (= M234), K268 (= K259)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G111), T119 (= T112), Y145 (= Y138), E207 (= E198), N212 (= N203), D240 (= D231), V242 (= V233), M243 (= M234), K268 (= K259)
5hdmA Crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase (see paper)
48% identity, 99% coverage: 4:420/420 of query aligns to 11:428/428 of 5hdmA
- active site: V22 (= V15), Y145 (= Y138), E207 (= E198), D240 (= D231), M243 (= M234), K268 (= K259), A402 (≠ T394)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G118 (= G111), T119 (= T112), Y145 (= Y138), G147 (= G140), E207 (= E198), N212 (= N203), D240 (= D231), V242 (= V233), K268 (= K259)
3k28A Crystal structure of a glutamate-1-semialdehyde aminotransferase from bacillus anthracis with bound pyridoxal 5'phosphate
50% identity, 96% coverage: 4:405/420 of query aligns to 11:407/423 of 3k28A
- active site: V22 (= V15), Y145 (= Y138), E202 (= E198), D235 (= D231), M238 (= M234), K263 (= K259), G396 (≠ T394)
- binding calcium ion: I103 (≠ L96), V106 (≠ F99), P107 (= P100), I109 (≠ L102)
- binding pyridoxal-5'-phosphate: G118 (= G111), T119 (= T112), Y145 (= Y138), H146 (= H139), G147 (= G140), E202 (= E198), D235 (= D231), V237 (= V233), M238 (= M234), K263 (= K259)
2gsaB Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
47% identity, 100% coverage: 3:420/420 of query aligns to 9:427/427 of 2gsaB
- active site: V21 (= V15), Y144 (= Y138), E206 (= E198), D239 (= D231), M242 (= M234), K267 (= K259), A401 (≠ T394)
- binding pyridoxal-5'-phosphate: G117 (= G111), T118 (= T112), Y144 (= Y138), E206 (= E198), N211 (= N203), D239 (= D231), V241 (= V233), M242 (= M234), K267 (= K259)
2gsaA Crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase, wild-type form) (see paper)
47% identity, 100% coverage: 3:420/420 of query aligns to 9:427/427 of 2gsaA
- active site: V21 (= V15), Y144 (= Y138), E206 (= E198), D239 (= D231), M242 (= M234), K267 (= K259), A401 (≠ T394)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G111), T118 (= T112), Y144 (= Y138), H145 (= H139), G146 (= G140), N211 (= N203), D239 (= D231), V241 (= V233), K267 (= K259)
3usfA Crystal structure of dava-4
47% identity, 100% coverage: 3:420/420 of query aligns to 9:427/427 of 3usfA
- active site: V21 (= V15), Y144 (= Y138), D239 (= D231), M242 (= M234), K267 (= K259), A401 (≠ T394)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S17), V25 (= V19), S157 (= S151), K267 (= K259), E400 (= E393)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G111), T118 (= T112), Y144 (= Y138), N211 (= N203), D239 (= D231), V241 (= V233), K267 (= K259)
3fq7A Gabaculine complex of gsam (see paper)
47% identity, 100% coverage: 3:420/420 of query aligns to 9:427/427 of 3fq7A
- active site: V21 (= V15), Y144 (= Y138), D239 (= D231), M242 (= M234), K267 (= K259), A401 (≠ T394)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: S23 (= S17), V25 (= V19), W61 (= W55), G117 (= G111), T118 (= T112), Y144 (= Y138), H145 (= H139), E206 (= E198), N211 (= N203), D239 (= D231), V241 (= V233), M242 (= M234), K267 (= K259), G298 (= G290), T299 (= T291), E400 (= E393)
2hp2A Inter-subunit signaling in gsam (see paper)
47% identity, 100% coverage: 3:420/420 of query aligns to 9:427/427 of 2hp2A
- active site: V21 (= V15), Y144 (= Y138), D239 (= D231), M242 (= M234), K267 (= K259), A401 (≠ T394)
- binding (4s)-4,5-diaminopentanoic acid: G298 (= G290), T299 (= T291)
- binding (4r)-5-amino-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S17), G117 (= G111), T118 (= T112), Y144 (= Y138), H145 (= H139), E206 (= E198), N211 (= N203), D239 (= D231), V241 (= V233), M242 (= M234), K267 (= K259)
- binding pyridoxal-5'-phosphate: G298 (= G290), T299 (= T291)
2hp1A Inter-subunit signaling in gsam (see paper)
47% identity, 100% coverage: 3:420/420 of query aligns to 9:427/427 of 2hp1A
- active site: V21 (= V15), Y144 (= Y138), D239 (= D231), M242 (= M234), K267 (= K259), A401 (≠ T394)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: S23 (= S17), V25 (= V19), W61 (= W55), S116 (= S110), G117 (= G111), T118 (= T112), Y144 (= Y138), H145 (= H139), G146 (= G140), E206 (= E198), N211 (= N203), D239 (= D231), V241 (= V233), M242 (= M234), K267 (= K259), E400 (= E393)
2hozA Inter-subunit signaling in gsam (see paper)
47% identity, 100% coverage: 3:420/420 of query aligns to 9:427/427 of 2hozA
- active site: V21 (= V15), Y144 (= Y138), D239 (= D231), M242 (= M234), K267 (= K259), A401 (≠ T394)
- binding (4s)-4,5-diaminopentanoic acid: E141 (= E135), G156 (= G150), S157 (= S151), P182 (≠ K176), N368 (= N361), E370 (≠ D363), K373 (≠ N366)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (= G111), T118 (= T112), Y144 (= Y138), H145 (= H139), G146 (= G140), E206 (= E198), N211 (= N203), D239 (= D231), G298 (= G290), T299 (= T291)
3fqaA Gabaculien complex of gabaculine resistant gsam version (see paper)
47% identity, 100% coverage: 3:420/420 of query aligns to 8:426/426 of 3fqaA
- active site: V20 (= V15), Y143 (= Y138), D238 (= D231), I241 (≠ M234), K266 (= K259), A400 (≠ T394)
- binding 3-aminobenzoic acid: S22 (= S17), R25 (= R20), W60 (= W55)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G116 (= G111), T117 (= T112), Y143 (= Y138), E205 (= E198), N210 (= N203), D238 (= D231), V240 (= V233), I241 (≠ M234)
3usfB Crystal structure of dava-4
43% identity, 100% coverage: 3:420/420 of query aligns to 9:402/402 of 3usfB
- active site: V21 (= V15), Y144 (= Y138), E181 (= E198), D214 (= D231), M217 (= M234), K242 (= K259), A376 (≠ T394)
- binding (4s)-4,5-diaminopentanoic acid: G273 (= G290), T274 (= T291)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: G117 (= G111), T118 (= T112), Y144 (= Y138), E181 (= E198), N186 (= N203), D214 (= D231), V216 (= V233), M217 (= M234), K242 (= K259)
2hp1B Inter-subunit signaling in gsam (see paper)
43% identity, 100% coverage: 3:420/420 of query aligns to 9:398/398 of 2hp1B
- active site: V21 (= V15), Y144 (= Y138), E177 (= E198), D210 (= D231), M213 (= M234), K238 (= K259), A372 (≠ T394)
- binding (4s)-4-amino-5-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: G269 (= G290), T270 (= T291)
- binding (4s)-4,5-diaminopentanoic acid: S23 (= S17), V25 (= V19), R26 (= R20), W61 (= W55), Y144 (= Y138)
- binding pyridoxal-5'-phosphate: S116 (= S110), G117 (= G111), T118 (= T112), Y144 (= Y138), E177 (= E198), N182 (= N203), D210 (= D231), V212 (= V233), M213 (= M234), K238 (= K259)
Query Sequence
>WP_007473232.1 NCBI__GCF_000170735.1:WP_007473232.1
MGIFNEAQKYIVGGVNSPVRAFKSVGGEPPFIEKGEGAYIFDIEGNKYLDYIQSWGPLIF
GHCDKDTQNAIIEAVKKGVSFGAPTKVEVELAKEVLELFPHLNLIRFVNSGTEATMSAIR
LARGYTGKDDIIKFEGCYHGHSDSLLVSAGSGAATFGVPSSPGVPADFTKHTLLAKYNDI
ESVKKCFENGDVGCVIIEPIAGNMSLVPGEKEFLGELREICNHYGAVLIFDEVMSGFRAS
LRGSFDIYGIKADIVTFGKVIGGGMPVGAFAGKKEIMEKLSPVGPVYQAGTLSGNPVAMS
AGLTVIKKLKENPEIYKELEDKAKKLMEGFSEISKENNIDFNYNVIGSMFGFFFNKKLPK
NFDEVNESDTKRYAKFHNNMLKSGFYFAPSAYETGFICTPMNEKDIENTITTYSKIVKEI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory