Comparing WP_007474421.1 NCBI__GCF_000170735.1:WP_007474421.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
5ygeA Arga complexed with acecoa and glutamate (see paper)
45% identity, 46% coverage: 59:131/158 of query aligns to 58:130/169 of 5ygeA
Sites not aligning to the query:
6addA The crystal structure of rv2747 from mycobacterium tuberculosis in complex with coa and nlq (see paper)
45% identity, 46% coverage: 59:131/158 of query aligns to 57:129/168 of 6addA
Sites not aligning to the query:
5yo2A The crystal structure of rv2747 from mycobacterium tuberculosis in complex with acetyl coa and l-arginine (see paper)
45% identity, 46% coverage: 59:131/158 of query aligns to 57:129/168 of 5yo2A
Sites not aligning to the query:
P0A6C5 Amino-acid acetyltransferase; N-acetylglutamate synthase; AGS; NAGS; EC 2.3.1.1 from Escherichia coli (strain K12) (see paper)
26% identity, 80% coverage: 9:135/158 of query aligns to 297:425/443 of P0A6C5
Sites not aligning to the query:
4i49A Structure of ngnags bound with bisubstrate analog coa-NAG (see paper)
26% identity, 75% coverage: 17:135/158 of query aligns to 284:404/424 of 4i49A
Sites not aligning to the query:
3d2mA Crystal structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and l-glutamate (see paper)
26% identity, 75% coverage: 17:135/158 of query aligns to 284:404/424 of 3d2mA
Sites not aligning to the query:
3b8gA Crysta structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and n-acetyl-glutamate (see paper)
26% identity, 75% coverage: 17:135/158 of query aligns to 284:404/424 of 3b8gA
Sites not aligning to the query:
2r8vA Native structure of n-acetylglutamate synthase from neisseria gonorrhoeae (see paper)
26% identity, 75% coverage: 17:135/158 of query aligns to 284:404/424 of 2r8vA
Sites not aligning to the query:
3d2pA Crystal structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and l-arginine (see paper)
26% identity, 75% coverage: 17:135/158 of query aligns to 292:408/424 of 3d2pA
Sites not aligning to the query:
>WP_007474421.1 NCBI__GCF_000170735.1:WP_007474421.1
MRFYGEIMKIIKPTLREIIDIKTVLKPYVDEGIILNRSDDEIATNIRSYQIVYDKKRPIG
VGALHIYSPYLGEIRSLAVNKEYQLKGIGKELVRNLLKEAKELGLKEVLVLTYKKEFFEK
LGFVEIQKEAVPDKKIWADCIKCKFFPSCNEIALITYL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory