SitesBLAST
Comparing WP_007474598.1 NCBI__GCF_000170735.1:WP_007474598.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
34% identity, 88% coverage: 33:302/307 of query aligns to 36:311/334 of 5aovA
- active site: L100 (≠ S96), R241 (= R231), D265 (= D254), E270 (= E259), H288 (= H279)
- binding glyoxylic acid: M52 (≠ N49), L53 (vs. gap), L53 (vs. gap), Y74 (≠ A70), A75 (= A71), V76 (≠ T72), G77 (= G73), R241 (= R231), H288 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T72), T104 (≠ V100), F158 (≠ L151), G159 (= G152), R160 (≠ S153), I161 (= I154), S180 (= S173), R181 (≠ T174), A211 (≠ H201), V212 (≠ A202), P213 (= P203), T218 (= T208), I239 (≠ V229), A240 (≠ G230), R241 (= R231), H288 (= H279), G290 (≠ A281)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 94% coverage: 1:290/307 of query aligns to 1:289/304 of 1wwkA
- active site: S96 (= S96), R230 (= R231), D254 (= D254), E259 (= E259), H278 (= H279)
- binding nicotinamide-adenine-dinucleotide: V100 (= V100), G146 (= G150), F147 (≠ L151), G148 (= G152), R149 (≠ S153), I150 (= I154), Y168 (= Y172), D169 (≠ S173), P170 (≠ T174), V201 (≠ A202), P202 (= P203), T207 (= T208), T228 (≠ V229), S229 (≠ G230), D254 (= D254), H278 (= H279), G280 (≠ A281)
6p2iA Acyclic imino acid reductase (bsp5) in complex with NADPH and d-arg (see paper)
34% identity, 99% coverage: 1:303/307 of query aligns to 1:298/307 of 6p2iA
- binding d-arginine: E51 (≠ N49), T73 (≠ A71), T74 (= T72), S75 (≠ G73), Y97 (= Y95), W277 (= W282)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S98 (= S96), V102 (= V100), G149 (= G150), I150 (≠ L151), G151 (= G152), Q152 (≠ S153), I153 (= I154), N172 (≠ S173), K173 (≠ T174), S174 (= S175), R176 (≠ N178), H199 (= H201), I200 (≠ A202), P201 (= P203), T206 (= T208), T227 (≠ V229), C228 (≠ G230), W277 (= W282)
2eklA Structure of st1218 protein from sulfolobus tokodaii
32% identity, 87% coverage: 32:299/307 of query aligns to 35:302/312 of 2eklA
- active site: S100 (= S96), R232 (= R231), D256 (= D254), E261 (= E259), H282 (= H279)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ T72), S100 (= S96), G148 (= G150), G150 (= G152), R151 (≠ S153), I152 (= I154), Y170 (= Y172), D171 (≠ S173), I172 (≠ T174), L173 (≠ S175), H202 (= H201), V203 (≠ A202), T204 (≠ P203), I212 (≠ L211), T230 (≠ V229), S231 (≠ G230), D256 (= D254), G284 (≠ A281)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
33% identity, 88% coverage: 33:302/307 of query aligns to 35:310/332 of 6biiA
- active site: L99 (≠ S96), R240 (= R231), D264 (= D254), E269 (= E259), H287 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ T72), T103 (≠ V100), G156 (= G150), F157 (≠ L151), G158 (= G152), R159 (≠ S153), I160 (= I154), A179 (≠ S173), R180 (≠ T174), S181 (= S175), K183 (= K177), V211 (≠ A202), P212 (= P203), E216 (≠ N207), T217 (= T208), V238 (= V229), A239 (≠ G230), R240 (= R231), D264 (= D254), H287 (= H279), G289 (≠ A281)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
32% identity, 89% coverage: 29:300/307 of query aligns to 32:300/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
32% identity, 89% coverage: 29:300/307 of query aligns to 30:298/311 of 3bazA
- active site: L98 (≠ S96), R230 (= R231), A251 (≠ I251), D254 (= D254), E259 (= E259), H277 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ T72), G149 (= G150), L150 (= L151), G151 (= G152), R152 (≠ S153), I153 (= I154), S172 (= S173), R173 (≠ T174), S174 (= S175), C201 (≠ A202), P202 (= P203), T207 (= T208), I228 (≠ V229), G229 (= G230), R230 (= R231), D254 (= D254), H277 (= H279), G279 (≠ A281)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
28% identity, 82% coverage: 53:304/307 of query aligns to 54:319/334 of 3kb6B
- active site: S97 (= S96), R231 (= R231), D255 (= D254), E260 (= E259), H294 (= H279)
- binding lactic acid: S72 (≠ A71), V73 (≠ T72), G74 (= G73), Y96 (= Y95), R231 (= R231), H294 (= H279)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ T72), Y96 (= Y95), V101 (= V100), G150 (= G152), R151 (≠ S153), I152 (= I154), D171 (≠ S173), V172 (≠ T174), P203 (= P203), T229 (≠ V229), A230 (≠ G230), R231 (= R231), H294 (= H279), A296 (= A281), Y297 (≠ W282)
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
31% identity, 87% coverage: 24:290/307 of query aligns to 22:289/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
31% identity, 87% coverage: 24:290/307 of query aligns to 21:288/526 of 3dc2A
Sites not aligning to the query:
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
30% identity, 90% coverage: 32:307/307 of query aligns to 37:311/533 of O43175
- T78 (= T72) binding
- R135 (= R123) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ SI 153:154) binding
- D175 (≠ S173) binding
- T207 (≠ A202) binding
- CAR 234:236 (≠ VGR 229:231) binding
- D260 (= D254) binding
- V261 (= V255) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVAW 279:282) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
30% identity, 89% coverage: 32:305/307 of query aligns to 33:305/305 of 6plfA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
30% identity, 89% coverage: 32:304/307 of query aligns to 32:303/303 of 6plgA
7dkmA Phgdh covalently linked to oridonin (see paper)
30% identity, 89% coverage: 32:304/307 of query aligns to 33:304/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T72), A102 (≠ V100), G148 (= G150), R151 (≠ S153), I152 (= I154), Y170 (= Y172), D171 (≠ S173), P172 (vs. gap), I173 (vs. gap), H202 (= H201), T203 (≠ A202), P204 (= P203), T209 (= T208), C230 (≠ V229), A231 (≠ G230), R232 (= R231), H279 (= H279), G281 (≠ A281)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ Q293)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
4lceA Ctbp1 in complex with substrate mtob (see paper)
29% identity, 96% coverage: 13:306/307 of query aligns to 13:320/327 of 4lceA
- active site: S98 (= S96), R240 (= R231), D264 (= D254), E269 (= E259), H289 (= H279)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: R71 (≠ I69), G73 (≠ A71), S74 (≠ T72), G75 (= G73), R240 (= R231), H289 (= H279), W292 (= W282)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T72), T102 (≠ V100), G155 (= G150), G157 (= G152), R158 (≠ S153), V159 (≠ I154), Y177 (= Y172), D178 (≠ S173), P179 (vs. gap), Y180 (vs. gap), H210 (= H201), C211 (≠ A202), N214 (= N205), N217 (≠ T208), T238 (≠ V229), A239 (≠ G230), R240 (= R231), W292 (= W282)
6cdfA Human ctbp1 (28-378) (see paper)
29% identity, 96% coverage: 13:306/307 of query aligns to 15:322/333 of 6cdfA
- binding 1,4-dihydronicotinamide adenine dinucleotide: T104 (≠ V100), G157 (= G150), R160 (≠ S153), V161 (≠ I154), Y179 (= Y172), D180 (≠ S173), P181 (vs. gap), Y182 (vs. gap), H212 (= H201), C213 (≠ A202), N219 (≠ T208), T240 (≠ V229), A241 (≠ G230), R242 (= R231), H291 (= H279), W294 (= W282)
6v89A Human ctbp1 (28-375) in complex with amp (see paper)
29% identity, 96% coverage: 13:306/307 of query aligns to 14:321/332 of 6v89A
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
29% identity, 96% coverage: 13:306/307 of query aligns to 14:321/331 of 1hl3A
- active site: S99 (= S96), R241 (= R231), D265 (= D254), E270 (= E259), H290 (= H279)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V100), G158 (= G152), R159 (≠ S153), V160 (≠ I154), D179 (≠ S173), Y181 (vs. gap), H211 (= H201), C212 (≠ A202), G213 (≠ P203), N218 (≠ T208), T239 (≠ V229), A240 (≠ G230), R241 (= R231), D265 (= D254), H290 (= H279)
- binding : M17 (≠ F16), V26 (= V25), A27 (≠ E26), F28 (≠ V27), C29 (≠ Y28), E36 (= E35), H38 (≠ I37), E39 (≠ D38)
Sites not aligning to the query:
1hkuA Ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission (see paper)
29% identity, 96% coverage: 13:306/307 of query aligns to 14:321/331 of 1hkuA
- active site: S99 (= S96), R241 (= R231), D265 (= D254), E270 (= E259), H290 (= H279)
- binding nicotinamide-adenine-dinucleotide: S75 (≠ T72), T103 (≠ V100), G156 (= G150), G158 (= G152), R159 (≠ S153), V160 (≠ I154), Y178 (= Y172), D179 (≠ S173), P180 (vs. gap), Y181 (vs. gap), C212 (≠ A202), N218 (≠ T208), T239 (≠ V229), A240 (≠ G230), R241 (= R231), H290 (= H279), W293 (= W282)
Sites not aligning to the query:
4u6sA Ctbp1 in complex with substrate phenylpyruvate (see paper)
29% identity, 96% coverage: 13:306/307 of query aligns to 14:321/328 of 4u6sA
- active site: S99 (= S96), R241 (= R231), D265 (= D254), E270 (= E259), H290 (= H279)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V100), G156 (= G150), G158 (= G152), R159 (≠ S153), V160 (≠ I154), Y178 (= Y172), D179 (≠ S173), P180 (vs. gap), Y181 (vs. gap), H211 (= H201), C212 (≠ A202), G213 (≠ P203), N218 (≠ T208), T239 (≠ V229), A240 (≠ G230), R241 (= R231), H290 (= H279), W293 (= W282)
- binding 3-phenylpyruvic acid: Y51 (≠ T48), H52 (≠ N49), I73 (≠ A70), G74 (≠ A71), S75 (≠ T72), G76 (= G73), R241 (= R231), W293 (= W282), M302 (≠ A287)
Query Sequence
>WP_007474598.1 NCBI__GCF_000170735.1:WP_007474598.1
MKIVFLDALTLGNVDFEKFKNLGEVEVYQITNKDELIDRVKNADIIVTNKVVIDKNVIDN
AKNLKFIQIAATGMNNVDLEYANKKGIIVKNVAGYSTNAVVQHTFALVLSLLNKICYFDK
YAREKYPYSPIFTHIQNWFEIKGKRWGIIGLGSIGREVAKVASSFGAEVIYYSTSGKNNS
NEYKRVDLDELLKTSKIITIHAPLNENTKNLLNYEKLNLIEDFSILVNVGRGGIINEKDL
ANILEKKDIFIGLDVFENEPINKDNPLLKFNEKTLLTPHVAWTSIEARNKLMQGIYRNIE
EFIKSSN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory