Comparing WP_007695789.1 NCBI__GCF_000336675.1:WP_007695789.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
33% identity, 72% coverage: 85:305/305 of query aligns to 79:278/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
30% identity, 42% coverage: 178:305/305 of query aligns to 169:293/296 of P68183
>WP_007695789.1 NCBI__GCF_000336675.1:WP_007695789.1
MSRGTTDRTLFDRLPGFDLSRALLYLLILFFVAFFLVPLETGLMTAFKTTQGVTNTLPFF
PPLGEAFTFQKWVDAFDMLGRGLVNSMVLTVPATLLCLLFGSTAAYGLTLINWRGQIFVL
VLFLIGIFIPYQAVLVPLSRFWSMVPLEEWLSPLYVLSFVQPEHAQLVELIITDAAYGIP
ICTLLFRGYYLSLPGDLIEAAKLDGASVTSIYRRIVLPLSTPMIGVVFIYQFTQIWNEFL
FTLTIVGSADSPAAPVTLILSGLGSSLSGVDFGMRMAGAFIAALPTLVIYVLFAEQFAEG
LETGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory