Comparing WP_007701722.1 NCBI__GCF_001277175.1:WP_007701722.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
P02903 Citrate lyase acyl carrier protein; Citrate lyase gamma chain from Klebsiella pneumoniae (see paper)
54% identity, 99% coverage: 1:96/97 of query aligns to 3:97/97 of P02903
>WP_007701722.1 NCBI__GCF_001277175.1:WP_007701722.1
MKIVKEALAGTAESSDLMVKIAPAAGELEIEIYSDVIKQFGDQIRRVVKETLAAMEVYEG
LVIIEDKGALDCVIRARLQSAVLRACEAQPLRWEALR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory