Comparing WP_007704698.1 NCBI__GCF_001277175.1:WP_007704698.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P46318 Lichenan-specific phosphotransferase enzyme IIB component; EIIB-Lic; PTS system lichenan-specific EIIB component; EC 2.7.1.- from Bacillus subtilis (strain 168) (see paper)
44% identity, 92% coverage: 3:96/102 of query aligns to 2:95/102 of P46318
2wy2D Nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. Coli phosphotransferase system. (see paper)
45% identity, 90% coverage: 2:93/102 of query aligns to 2:91/103 of 2wy2D
P69795 PTS system N,N'-diacetylchitobiose-specific EIIB component; EIIB-Chb; IVcel; N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIB component; EC 2.7.1.196 from Escherichia coli (strain K12) (see 2 papers)
45% identity, 90% coverage: 2:93/102 of query aligns to 4:93/106 of P69795
>WP_007704698.1 NCBI__GCF_001277175.1:WP_007704698.1
MKNIVLCCAAGMSTSMLVQRMKDAAQKKGVEVAIKAVPVAEFKDIIGTADIVLLGPQVKY
EQPKFQEIADPLGKKVAVIDMMDYGMMKGDVVLDKALKMLEQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory