Comparing WP_008485272.1 NCBI__GCF_000299915.1:WP_008485272.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
23% identity, 97% coverage: 2:146/150 of query aligns to 501:646/650 of O31645
Sites not aligning to the query:
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
24% identity, 67% coverage: 47:146/150 of query aligns to 42:141/144 of 1j6tA
>WP_008485272.1 NCBI__GCF_000299915.1:WP_008485272.1
MELNEILRPDAVVTLAPGLSKKRVLEMIGEVAARQCNQITAHAAFDAMLARERLGSTGIG
NGIALPHGRMTDTDKVVAVVARLSQAIDFDAIDNQPVDLLFALLVPSDQCQAHLTTLAAI
AKRLSDKETLKKLRSASDDNEVYRILVDAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory