Comparing WP_008498990.1 NCBI__GCF_000342445.1:WP_008498990.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3ngjD Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
58% identity, 96% coverage: 4:216/222 of query aligns to 10:221/222 of 3ngjD
Sites not aligning to the query:
Q4ZMV1 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Pseudomonas syringae pv. syringae (strain B728a) (see paper)
56% identity, 99% coverage: 4:222/222 of query aligns to 9:226/226 of Q4ZMV1
1ub3A Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 (see paper)
41% identity, 95% coverage: 3:213/222 of query aligns to 1:210/211 of 1ub3A
6z9iB Escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products (see paper)
35% identity, 90% coverage: 8:206/222 of query aligns to 13:223/248 of 6z9iB
Sites not aligning to the query:
P0A6L0 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 90% coverage: 8:206/222 of query aligns to 15:225/259 of P0A6L0
Sites not aligning to the query:
1jcjA Observation of covalent intermediates in an enzyme mechanism at atomic resolution (see paper)
34% identity, 90% coverage: 8:206/222 of query aligns to 16:226/252 of 1jcjA
Sites not aligning to the query:
5el1A Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment (see paper)
34% identity, 90% coverage: 8:206/222 of query aligns to 13:223/248 of 5el1A
Sites not aligning to the query:
5ekyA Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) (see paper)
34% identity, 90% coverage: 8:206/222 of query aligns to 13:223/248 of 5ekyA
Sites not aligning to the query:
7p76A Re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde (see paper)
33% identity, 90% coverage: 8:206/222 of query aligns to 12:222/247 of 7p76A
3q2dA Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution (see paper)
31% identity, 87% coverage: 13:206/222 of query aligns to 16:221/246 of 3q2dA
Sites not aligning to the query:
Q9Y315 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Homo sapiens (Human) (see paper)
31% identity, 86% coverage: 6:197/222 of query aligns to 52:269/318 of Q9Y315
8forA Crystal structure of kemp eliminase ke70-core with bound transition state analogue
30% identity, 86% coverage: 16:206/222 of query aligns to 21:223/249 of 8forA
Sites not aligning to the query:
3qyqA 1.8 angstrom resolution crystal structure of a putative deoxyribose- phosphate aldolase from toxoplasma gondii me49 (see paper)
28% identity, 76% coverage: 4:171/222 of query aligns to 16:192/273 of 3qyqA
Sites not aligning to the query:
>WP_008498990.1 NCBI__GCF_000342445.1:WP_008498990.1
MTNIASYIDHTLLKPESTESQVVQLCKEAAEYNFASVCVNPTWVEKAAAELTNSEVKVCT
VIGFPLGASTPETKAFETTDAISKGAGEIDMVLNIGALKSGNTDHVKKDIEAVVNAAKGK
AIVKVILETCLLTDEEKVTASQLSKEAGADFVKTSTGFSTGGATVEDVKLMRQTVGPDMG
IKASGGVRSLEDVEAMIEAGATRIGASSGVKIMQGLTSDSDY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory