Comparing WP_008507762.1 NCBI__GCF_000182725.1:WP_008507762.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7bywA Crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose- bound form) (see paper)
62% identity, 95% coverage: 7:114/114 of query aligns to 1:108/108 of 7bywA
2qlxA Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum in complex with l-rhamnose (see paper)
31% identity, 63% coverage: 15:86/114 of query aligns to 14:82/108 of 2qlxA
Sites not aligning to the query:
2qlwB Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum (see paper)
31% identity, 63% coverage: 15:86/114 of query aligns to 14:82/108 of 2qlwB
Sites not aligning to the query:
1x8dA Crystal structure of e. Coli yiil protein containing l-rhamnose (see paper)
35% identity, 46% coverage: 8:59/114 of query aligns to 3:54/104 of 1x8dA
Sites not aligning to the query:
P32156 L-rhamnose mutarotase; Rhamnose 1-epimerase; Type-3 mutarotase; EC 5.1.3.32 from Escherichia coli (strain K12) (see paper)
35% identity, 46% coverage: 8:59/114 of query aligns to 3:54/104 of P32156
>WP_008507762.1 NCBI__GCF_000182725.1:WP_008507762.1
MSKHQGQRMGMVIGLNPEKVAKYKALHAQVWPEILALISECNIANYSIFLKEPENLLFGY
WEYVGSDFAADMRKMAESPKNQEWWSVCMPCQKPLETRKEGEWWAMMEEVFHHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory