Comparing WP_008509924.1 NCBI__GCF_000182725.1:WP_008509924.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
2x65B Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
34% identity, 73% coverage: 6:348/471 of query aligns to 5:332/334 of 2x65B
2x65A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
34% identity, 73% coverage: 6:348/471 of query aligns to 5:332/334 of 2x65A
2x60A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gtp. (see paper)
34% identity, 73% coverage: 6:348/471 of query aligns to 5:332/333 of 2x60A
2x5zA Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gdp-mannose. (see paper)
34% identity, 73% coverage: 6:348/471 of query aligns to 5:332/333 of 2x5zA
>WP_008509924.1 NCBI__GCF_000182725.1:WP_008509924.1
MSFIPVIISGGSGSRLWPLSRDAHPKPFIKLPDGETLIGKTYARASRLANVEQILTVTNR
DFLFLTLDAYAAAGAAQMENTFLLEPLGRDTAPAVALAALHAAEAYGPDATLLVMPADHL
IEDEQAFAEAVAKARALAEAGRIVTFGIVPDRPETGFGYIEVQGTDVQRFVEKPDEATAQ
TYVESGRYFWNSGMFCFKASSMIDAMQRHAPQVLAGARAALAQARRGNNGETKTLEIARD
EFAATPAISIDYAVMEKADNMACVPVSCGWSDIGSWAAMADLVTPDENGNRLRGETVLED
TTNSFVLSETRLVSLVGVHDLLVVDTPDALLVAHRDKAQEVRSVFNKLRKQGHEAAKLHR
TAHRPWGTYTVLEEGDGFKIKRIEVKPGRRLSLQAHHHRSEHWIVVSGTAKVTNGDREIL
LTTNQSTYIPCGFRHRLENPGILPLVLIEVQSGEYLGEDDIVRYDDVYGRV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory