Comparing WP_008804517.1 NCBI__GCF_000025465.1:WP_008804517.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 96% coverage: 12:382/385 of query aligns to 49:423/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 93% coverage: 12:368/385 of query aligns to 11:362/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 98% coverage: 2:377/385 of query aligns to 43:422/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 86% coverage: 15:345/385 of query aligns to 20:350/389 of 4ewtA
Sites not aligning to the query:
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
39% identity, 69% coverage: 18:284/385 of query aligns to 26:294/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
28% identity, 63% coverage: 18:259/385 of query aligns to 25:248/391 of 3ramA
Sites not aligning to the query:
7yh4A Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (pm20d2)
26% identity, 63% coverage: 16:259/385 of query aligns to 30:263/400 of 7yh4A
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
26% identity, 46% coverage: 121:299/385 of query aligns to 131:298/373 of 3rzaA
Sites not aligning to the query:
>WP_008804517.1 NCBI__GCF_000025465.1:WP_008804517.1
MAVSPSLIAEAVGWRREFHAAPELGYQEQETSRRVAELLASFGLQVHRGLAGTGVVATLE
NGPGPVIGLRADMDALPITELGSVSYRSRRPGVMHACGHDGHTAMLLAAAAHLAQTRQFS
GTVHFVFQPAEENLGGARKMVEEGLFERFPMDAIYALHNWPGIPLGEVALSDGAMMASLD
AFEITLRGKSCHAAMPESGADPIVAAAQLIMALQTIPSRRLSPQDSAVVSITQINGGEAI
NVLPDTVVLRGTFRCLSNRVRARVRELIESYVATQPQVSDVQGEISWFPGYPVTKNHALQ
AQQVREVAVATLGAEAVRWNQAPSMASEDFACMLEACPGAYFWIGTDGETPSKPLHNASY
DFNDALISPGVAMWVALVEKQLPAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory