Comparing WP_008807530.1 NCBI__GCF_000025465.1:WP_008807530.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
3qnmA Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
30% identity, 99% coverage: 1:222/225 of query aligns to 1:230/231 of 3qnmA
3i76B The crystal structure of the orthorhombic form of the putative had- hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
27% identity, 98% coverage: 2:222/225 of query aligns to 2:226/229 of 3i76B
4knvA The crystal structure of apo human hdhd4 from se-mad (see paper)
31% identity, 96% coverage: 6:222/225 of query aligns to 4:232/241 of 4knvA
6q7oA Crystal structure of oe1 (see paper)
33% identity, 56% coverage: 98:222/225 of query aligns to 103:226/230 of 6q7oA
Sites not aligning to the query:
6q7nA Crystal structure of bh32 alkylated with the mechanistic inhibitor 2- bromoacetophenone (see paper)
33% identity, 56% coverage: 98:222/225 of query aligns to 103:226/230 of 6q7nA
Sites not aligning to the query:
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
32% identity, 49% coverage: 112:222/225 of query aligns to 104:210/215 of 4ygrA
Sites not aligning to the query:
8bp1A Crystal structure of bhmehis1.0, an engineered enzyme for the morita- baylis-hillman reaction (see paper)
32% identity, 56% coverage: 98:222/225 of query aligns to 103:226/231 of 8bp1A
Sites not aligning to the query:
3vayA Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. Tomato dc3000 (see paper)
31% identity, 57% coverage: 97:224/225 of query aligns to 107:228/230 of 3vayA
Sites not aligning to the query:
1zrmA Crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate (see paper)
32% identity, 63% coverage: 82:222/225 of query aligns to 85:220/220 of 1zrmA
Sites not aligning to the query:
Q53464 (S)-2-haloacid dehalogenase; 2-haloalkanoic acid dehalogenase; Halocarboxylic acid halidohydrolase; L-2-haloacid dehalogenase; L-DEX; EC 3.8.1.2 from Pseudomonas sp. (strain YL) (see 2 papers)
32% identity, 63% coverage: 82:222/225 of query aligns to 87:222/232 of Q53464
Sites not aligning to the query:
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
29% identity, 64% coverage: 82:225/225 of query aligns to 84:226/226 of 2no5B
Sites not aligning to the query:
3r09A Crystal structure of probable had family hydrolase from pseudomonas fluorescens pf-5 with bound mg
28% identity, 91% coverage: 19:222/225 of query aligns to 1:194/197 of 3r09A
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
29% identity, 64% coverage: 82:225/225 of query aligns to 84:226/231 of Q51645
Sites not aligning to the query:
Q9HZ62 N-acetylmuramic acid 6-phosphate phosphatase; MurNAc 6-phosphate phosphatase; MurNAc-6P phosphatase; EC 3.1.3.105 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
29% identity, 63% coverage: 82:222/225 of query aligns to 73:219/226 of Q9HZ62
Sites not aligning to the query:
>WP_008807530.1 NCBI__GCF_000025465.1:WP_008807530.1
MKWDWIFFDADETLFSFDSFSGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGVITS
LQLQHQRFDSWAERLNVKPGELNDAFMNAMAEICAPLPGAVSLLNALQGKVRMGIITNGF
TSLQQTRLERTGLRDHFDLLIISEEVGVAKPDARIFDYALAQAGNPPRSRVLMVGDTAES
DIRGGVNAGLATCWLNAHQQTLPVDLQPDWTVTSLSELEQLLCKH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory