Comparing WP_009064810.1 NCBI__GCF_000016505.1:WP_009064810.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
4gyfA Crystal structure of histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. Lactis il1403 complexed with zn, l- histidinol and phosphate
33% identity, 96% coverage: 4:270/277 of query aligns to 6:260/263 of 4gyfA
Sites not aligning to the query:
4gk8A Crystal structure of histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. Lactis il1403 complexed with zn and l- histidinol arsenate (see paper)
33% identity, 96% coverage: 4:270/277 of query aligns to 6:260/263 of 4gk8A
4gc3A Crystal structure of l-histidinol phosphate phosphatase (hisk) from lactococcus lactis subsp. Lactis il1403 complexed with zn and sulfate (see paper)
33% identity, 96% coverage: 4:270/277 of query aligns to 6:260/263 of 4gc3A
2yz5A Histidinol phosphate phosphatase complexed with phosphate (see paper)
26% identity, 93% coverage: 4:261/277 of query aligns to 3:248/263 of 2yz5A
2yxoB Histidinol phosphate phosphatase complexed with sulfate (see paper)
26% identity, 93% coverage: 4:261/277 of query aligns to 3:248/265 of 2yxoB
>WP_009064810.1 NCBI__GCF_000016505.1:WP_009064810.1
MFADYHVHTEFSDDSVYEMEEVVKDAIQIKMEEICFTDHVDYGVKLDWNDKKEIQYRDGM
PMANVYYPEYFETIKELQYLYGDLIAIKKGMEFGVQVHTISQYEKLFVKYPFDFIILSVH
QIDNLELWTQDFQKGKSQKEYNEKYYQELLEIVKQYKNYSVLGHLDIIIRYDKNGTYPFE
KISDIVNEILKIVIRDGKGIEVNTSSYRYGLTDMTPSKDILTLYKKLGGEIITIGSDSHK
KGQLGAHIENTKKVLFDMGFRYHCTYENMRPHFHKLI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory