Comparing WP_009140205.1 NCBI__GCF_000225705.1:WP_009140205.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
35% identity, 77% coverage: 34:177/186 of query aligns to 503:646/648 of P09323
Sites not aligning to the query:
1glcF Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
32% identity, 79% coverage: 31:177/186 of query aligns to 14:159/161 of 1glcF
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
32% identity, 79% coverage: 31:177/186 of query aligns to 22:167/169 of P69783
Sites not aligning to the query:
1o2fA Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
32% identity, 79% coverage: 31:177/186 of query aligns to 3:148/150 of 1o2fA
>WP_009140205.1 NCBI__GCF_000225705.1:WP_009140205.1
MILVDKIKKSLGFSSETVEHPSATFATRPDSIYAPISGVLVELSEIDDDSISSGLFGRGY
GIVPVGNVIYAPANGRIAATTVSNHSIGLRTDNGIELIIHVGIDTVKMEGKGFNRLVESE
QEVKAGQPILVFDDDAIKAAGYDDVVTVIVTSPSLLDKVKLVGQSNTLFADHPLVKIGDP
LVVVKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory