Comparing WP_009140808.1 NCBI__GCF_000225705.1:WP_009140808.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P69797 PTS system mannose-specific EIIAB component; EIIAB-Man; EIII-Man; EC 2.7.1.191 from Escherichia coli (strain K12) (see 4 papers)
42% identity, 91% coverage: 6:151/160 of query aligns to 164:310/323 of P69797
Sites not aligning to the query:
P26380 PTS system fructose-specific EIIB component; EIIB-Fru; Fructose-specific phosphotransferase enzyme IIB component; lev-PTS; p18; EC 2.7.1.202 from Bacillus subtilis (strain 168) (see paper)
37% identity, 94% coverage: 5:155/160 of query aligns to 3:154/163 of P26380
>WP_009140808.1 NCBI__GCF_000225705.1:WP_009140808.1
MAEPNILLTRIDNRLIHGQVATQWNSTLGSNLILVANDEVSGNTMRQNLMKMAAPAGVAT
RFFSLQHTIDIIAKASPKQKIFIVAETPQDVLTLVKGGVPIRKVNIGNMHMSEGKRQVAT
SVAVDDADVAAFKELQELGVELEIRRVPSTPVEDINKLFS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory