Comparing WP_009142420.1 NCBI__GCF_000188195.1:WP_009142420.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 42% coverage: 72:264/458 of query aligns to 90:286/583 of Q9Y7Q9
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 74% coverage: 81:419/458 of query aligns to 188:518/616 of P36035
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 34% coverage: 79:232/458 of query aligns to 104:265/572 of O42885
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
28% identity, 36% coverage: 74:240/458 of query aligns to 56:207/403 of P77589
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 39% coverage: 79:256/458 of query aligns to 99:284/559 of Q09852
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
27% identity, 32% coverage: 89:233/458 of query aligns to 78:208/452 of Q5EXK5
Sites not aligning to the query:
8fvzA Pipt y150a
26% identity, 41% coverage: 52:237/458 of query aligns to 29:214/433 of 8fvzA
Sites not aligning to the query:
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
29% identity, 26% coverage: 64:184/458 of query aligns to 148:255/555 of Q9R0W2
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
26% identity, 48% coverage: 50:268/458 of query aligns to 24:231/446 of A0A0H2VG78
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 37% coverage: 75:244/458 of query aligns to 84:238/444 of Q8NLB7
Sites not aligning to the query:
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
25% identity, 38% coverage: 2:177/458 of query aligns to 4:165/448 of Q51955
Sites not aligning to the query:
>WP_009142420.1 NCBI__GCF_000188195.1:WP_009142420.1
MSENNIHTQAAEANFQTEEGKKDFWRATISCWLGTTMEYTDFALYGLAAGIIFGEVFFPE
STPVMALLQSFAAFSVGFIARPIGAIVFGMLGDKMGRKFVMVITISLMGLATTCIGLIPS
YEKIGAWSAALLVLMRFMQGLGAGAELSGGAVMLGEYAPVKRRGVVSSIIGLGSNSGTLL
ASAVWLLVLQLDHDDLMSWGWRIPFLGSILIAYIALLIRKHMRETPVFEKQKKQLEKMRK
EAFEKGVELQKKDKRSFFARTKAFWVMVGLRIGENGPSYLAQGFIIGYVVSFLSVDKSVA
TMSVFVASVLGFFIIPFSGWLSDKFGRRITYRWFCILLVLWAFPAFMLLDTKEPWIVGPV
IVIGMGLASLGIFGVQAAWGVELFGVTNRYTKMAFAKELGSIMSGGTAPMIASALLSYYG
HWWPIATYFAVCAFIGLVSTFIAPETRGRDLNLPEDAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory