Comparing WP_009319350.1 NCBI__GCF_000473955.1:WP_009319350.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
6n2oC 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
29% identity, 98% coverage: 5:180/180 of query aligns to 7:182/572 of 6n2oC
Sites not aligning to the query:
6n2oA 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
29% identity, 98% coverage: 5:180/180 of query aligns to 7:182/572 of 6n2oA
Sites not aligning to the query:
6n2nA Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
29% identity, 98% coverage: 5:180/180 of query aligns to 7:182/572 of 6n2nA
Sites not aligning to the query:
>WP_009319350.1 NCBI__GCF_000473955.1:WP_009319350.1
MKEEIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTANVTVILSDERIS
SPVLNTFDVAIILNQPSLEKFENKVKPGGILIYDGYGIHHAPTRKDIDIYRIDAMDTAIE
MENSKAFNMIVLGGLLKVKPMVSLENVLKGLKKSLPERHHKLIPMNEQAILKGMEIIRKV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory