Comparing WP_009319352.1 NCBI__GCF_000473955.1:WP_009319352.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
6n2oC 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
29% identity, 99% coverage: 3:358/359 of query aligns to 197:571/572 of 6n2oC
Sites not aligning to the query:
6n2oA 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
29% identity, 99% coverage: 3:358/359 of query aligns to 197:571/572 of 6n2oA
Sites not aligning to the query:
6n2nA Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
29% identity, 99% coverage: 3:358/359 of query aligns to 197:571/572 of 6n2nA
Q96XT2 2-oxoacid:ferredoxin oxidoreductase 2, subunit alpha; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
26% identity, 92% coverage: 29:358/359 of query aligns to 254:615/628 of Q96XT2
5b47A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
26% identity, 92% coverage: 29:358/359 of query aligns to 253:614/627 of 5b47A
5b46A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
26% identity, 92% coverage: 29:358/359 of query aligns to 253:614/627 of 5b46A
P72578 2-oxoacid:ferredoxin oxidoreductase subunit alpha; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see 2 papers)
27% identity, 86% coverage: 8:316/359 of query aligns to 232:572/632 of P72578
Q96Y66 2-oxoacid:ferredoxin oxidoreductase 1, subunit alpha; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
27% identity, 86% coverage: 8:316/359 of query aligns to 232:572/627 of Q96Y66
Sites not aligning to the query:
5b48A 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
33% identity, 52% coverage: 8:192/359 of query aligns to 200:394/576 of 5b48A
9bt4A Pyruvate:ferredoxin oxidoreductase from methanosarcina acetivorans (see paper)
26% identity, 81% coverage: 7:296/359 of query aligns to 12:309/402 of 9bt4A
5exeA Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
24% identity, 99% coverage: 5:358/359 of query aligns to 3:374/394 of 5exeA
5exdD Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
24% identity, 99% coverage: 5:358/359 of query aligns to 3:374/394 of 5exdD
5c4iA Structure of an oxalate oxidoreductase (see paper)
24% identity, 99% coverage: 5:358/359 of query aligns to 3:374/394 of 5c4iA
6ciqA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with coenzyme a bound (see paper)
22% identity, 82% coverage: 6:298/359 of query aligns to 3:308/1169 of 6ciqA
Sites not aligning to the query:
6cinB Crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica (see paper)
22% identity, 82% coverage: 6:298/359 of query aligns to 3:308/1169 of 6cinB
Sites not aligning to the query:
Q2RMD6 Pyruvate:ferredoxin oxidoreductase; PFOR; Pyruvate synthase; EC 1.2.7.1 from Moorella thermoacetica (strain ATCC 39073 / JCM 9320) (see paper)
22% identity, 82% coverage: 6:298/359 of query aligns to 4:309/1171 of Q2RMD6
Sites not aligning to the query:
6cioA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound (see paper)
22% identity, 82% coverage: 6:298/359 of query aligns to 3:308/1164 of 6cioA
Sites not aligning to the query:
6cipA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound (see paper)
22% identity, 82% coverage: 6:298/359 of query aligns to 3:308/1165 of 6cipA
Sites not aligning to the query:
>WP_009319352.1 NCBI__GCF_000473955.1:WP_009319352.1
MTEDVKLMKGNEAIAHAAIRYGADGYFGYPITPQSEIMETLMELKPWETTGMVVLQAESE
VAAINMVYGGAGCGKAVMTSSSSPGVSLKQEGISYIAGAELPCLIVNVMRGGPGLGTIQP
SQADYFQTVKGGGHGDYRLITLAPASVQEMADFVALGFDLAFKYNNPAIILADGIIGQMM
EKVVLPPFRPRRTEEEIRKQMPWATQGKLAGHKRNVITSLELDPAIMEENNIRFQAKYRK
IEEAEVRYEEIGCENADYLMIAFGSMARICLKTQEMALAEGIKVGVLRPITLWPFPSKII
AEYANKVKGMISVELNAGQMVEDIRLAVNGKVKVEHFGRLGGIVPTPDEVLNALKQKLM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory