Comparing WP_009488335.1 NCBI__GCF_000313915.1:WP_009488335.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
52% identity, 96% coverage: 2:327/341 of query aligns to 5:325/325 of 1xcoD
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
40% identity, 97% coverage: 2:331/341 of query aligns to 6:339/339 of 6ioxA
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
42% identity, 95% coverage: 3:326/341 of query aligns to 391:709/714 of Q8ZND6
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
40% identity, 95% coverage: 3:326/341 of query aligns to 3:327/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
40% identity, 95% coverage: 3:326/341 of query aligns to 4:328/333 of P38503
Sites not aligning to the query:
6zngF Maeb full-length acetyl-coa bound state (see paper)
36% identity, 91% coverage: 17:326/341 of query aligns to 439:743/753 of 6zngF
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
27% identity, 91% coverage: 17:326/341 of query aligns to 444:754/759 of P76558
Sites not aligning to the query:
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
27% identity, 42% coverage: 165:308/341 of query aligns to 130:268/288 of 3u9eB
Sites not aligning to the query:
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
27% identity, 42% coverage: 165:308/341 of query aligns to 128:266/285 of 3uf6A
Sites not aligning to the query:
>WP_009488335.1 NCBI__GCF_000313915.1:WP_009488335.1
MDFFEQLKMKLKDQNVRLVFPEATDERIIKACARLQAEHLIQPVLLGDKEEIEPIAYRCG
VLIDEIEFINPKTYPRLEEMIDTLFTRRNGKITKEEARELVQDVNYFGTMLTYMGIVDGM
VSGAIHSTGDTVRPALQIIKTKPGVKRTSGAFLLLRGRGDQERYLFSDCAINVDPDAPLL
AEIAMETAKTAESLGIPPRVAMLSYSTNGSGSGPAVDKVKEALEIIKEKNQDPNAIFEGE
IQFDAAYDKTVADLKYPDSKIAGKCTVFVFPELQSGNIGYKIAQRLGGFDAIGPILQGLN
KPISDLSRGACTNDVYKVSLITAMQALMDKDEANDSEIKNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory