SitesBLAST
Comparing WP_009547444.1 NCBI__GCF_000017845.1:WP_009547444.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5tprA Desmethyl-4-deoxygadusol synthase from anabaena variabilis (ava_3858) with NAD+ and zn2+ bound (see paper)
40% identity, 88% coverage: 47:433/440 of query aligns to 12:396/400 of 5tprA
- active site: R132 (= R169), K154 (≠ R191), E196 (= E233), M248 (≠ Y285), E258 (= E295), D262 (= D299), A266 (= A303), H269 (= H306), P273 (= P310), H285 (= H320)
- binding nicotinamide-adenine-dinucleotide: D54 (= D89), N56 (≠ T91), V57 (= V92), E85 (= E120), K88 (= K123), G116 (= G153), G117 (= G154), L118 (≠ V155), D121 (= D158), T141 (= T178), T142 (= T179), I144 (≠ V181), D148 (= D185), A149 (= A186), K163 (= K200), T184 (= T221), L185 (= L222), Q189 (≠ H226)
- binding zinc ion: E196 (= E233), H269 (= H306), H285 (= H320)
Q3M6C3 Demethyl-4-deoxygadusol synthase; DDGS; EC 4.2.3.154 from Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) (see paper)
40% identity, 88% coverage: 47:433/440 of query aligns to 14:398/410 of Q3M6C3
H2K887 2-epi-5-epi-valiolone synthase; EEVS; Sedoheptulose 7-phosphate cyclase; EC 4.2.3.152 from Streptomyces hygroscopicus subsp. jinggangensis (strain 5008) (see paper)
36% identity, 84% coverage: 44:413/440 of query aligns to 22:391/414 of H2K887
4p53A Vala (2-epi-5-epi-valiolone synthase) from streptomyces hygroscopicus subsp. Jinggangensis 5008 with NAD+ and zn2+ bound (see paper)
36% identity, 78% coverage: 71:413/440 of query aligns to 22:353/360 of 4p53A
- active site: R117 (= R169), K139 (≠ R191), E181 (= E233), M225 (≠ Y285), E235 (= E295), R239 (≠ D299), D243 (≠ A303), H246 (= H306), P250 (= P310), H262 (= H320)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D38 (= D89), T40 (= T91), V41 (= V92), L44 (= L95), E69 (= E120), K72 (= K123), G101 (= G153), G102 (= G154), V103 (= V155), D106 (= D158), T126 (= T178), T127 (= T179), I129 (≠ V181), D133 (= D185), A134 (= A186), K148 (= K200), T169 (= T221), L170 (= L222), H174 (= H226), H262 (= H320)
- binding zinc ion: E181 (= E233), H246 (= H306), H262 (= H320)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
28% identity, 67% coverage: 111:404/440 of query aligns to 52:330/343 of P56081
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
27% identity, 79% coverage: 71:419/440 of query aligns to 24:361/361 of Q9KNV2
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
27% identity, 79% coverage: 71:419/440 of query aligns to 25:360/360 of 3okfA
- active site: R120 (= R169), K142 (≠ R191), E184 (= E233), K226 (≠ R280), R238 (≠ E295), N242 (≠ D299), H245 (= H302), H249 (= H306), H262 (= H320)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D89), L48 (= L95), D71 (≠ A118), E73 (= E120), K76 (= K123), G104 (= G153), G105 (= G154), V106 (= V155), D109 (= D158), T129 (= T178), T130 (= T179), L132 (≠ V181), D136 (= D185), T172 (= T221), L173 (= L222), E177 (≠ H226)
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
29% identity, 57% coverage: 111:362/440 of query aligns to 49:277/308 of 3clhA
- active site: R107 (= R169), K129 (≠ R191), E171 (= E233), K207 (≠ F283), R212 (≠ H288), N216 (= N292), H219 (= H306), H223 (≠ P310), H236 (= H320)
- binding nicotinamide-adenine-dinucleotide: S58 (= S121), E60 (≠ K123), K63 (≠ Q126), G91 (= G153), G92 (= G154), V93 (= V155), D96 (= D158), T116 (= T178), T117 (= T179), L119 (≠ V181), D123 (= D185), A124 (= A186), K129 (≠ R191), N139 (= N201), T159 (= T221), L160 (= L222), E164 (≠ H226)
Sites not aligning to the query:
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
26% identity, 68% coverage: 67:365/440 of query aligns to 22:306/355 of 5eksA
- active site: R120 (= R169), K142 (≠ R191), E184 (= E233), K226 (≠ E289), R237 (= R300), N241 (vs. gap), H244 (= H302), H248 (= H306), H261 (= H320)
- binding magnesium ion: E184 (= E233), H244 (= H302), H261 (= H320)
- binding nicotinamide-adenine-dinucleotide: N42 (≠ D89), V45 (= V92), D71 (≠ E120), E73 (≠ D122), K76 (≠ P125), G104 (= G153), G105 (= G154), V106 (= V155), D109 (= D158), T129 (= T178), T130 (= T179), D136 (= D185), S137 (≠ A186), K142 (≠ R191), T172 (= T221), L173 (= L222), E177 (≠ H226)
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
28% identity, 54% coverage: 120:358/440 of query aligns to 78:315/381 of 1dqsA
- active site: R127 (= R169), K149 (≠ R191), E191 (= E233), K240 (≠ R280), E250 (= E289), R254 (≠ E295), N258 (≠ D299), H261 (= H302), H265 (= H306), H277 (= H320)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D185), K149 (≠ R191), N159 (= N201), E191 (= E233), K240 (≠ R280), R254 (≠ E295), L257 (≠ Q298), N258 (≠ D299), H261 (= H302), H265 (= H306), H277 (= H320)
- binding nicotinamide-adenine-dinucleotide: E78 (= E120), K81 (= K123), G111 (= G153), G112 (= G154), V113 (= V155), D116 (= D158), T136 (= T178), T137 (= T179), L139 (≠ V181), D143 (= D185), S144 (≠ A186), K158 (= K200), T179 (= T221), P181 (≠ D223), E184 (≠ H226), H277 (= H320)
- binding zinc ion: E191 (= E233), H261 (= H302), H277 (= H320)
Sites not aligning to the query:
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
29% identity, 55% coverage: 120:362/440 of query aligns to 75:307/362 of P9WPX9
Sites not aligning to the query:
3qbdA 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis in complex with NAD
30% identity, 55% coverage: 120:360/440 of query aligns to 70:295/344 of 3qbdA
- active site: R117 (= R169), K139 (≠ R191), E181 (= E233), K223 (≠ Y285), R232 (≠ F294), N236 (≠ Q298), H239 (= H306), H243 (≠ P310), H255 (= H320)
- binding nicotinamide-adenine-dinucleotide: E70 (= E120), K73 (= K123), G101 (= G153), G102 (= G154), A103 (≠ V155), D106 (= D158), T126 (= T178), T127 (= T179), L129 (≠ V181), A134 (= A186), T169 (= T221), L170 (= L222)
Sites not aligning to the query:
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
29% identity, 55% coverage: 120:362/440 of query aligns to 70:298/352 of 3qbeA
- active site: R117 (= R169), K139 (≠ R191), E181 (= E233), K223 (≠ Y285), R233 (≠ E295), N237 (≠ D299), H240 (= H302), H244 (= H306), H256 (= H320)
- binding zinc ion: E181 (= E233), H240 (= H302), H256 (= H320)
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
28% identity, 55% coverage: 120:360/440 of query aligns to 83:321/385 of 6c5cA
- active site: R130 (= R169), K152 (≠ R191), E194 (= E233), K246 (≠ H288), E254 (≠ T296), R258 (= R300), N262 (vs. gap), H265 (= H302), H269 (= H306), H281 (= H320)
- binding nicotinamide-adenine-dinucleotide: E83 (= E120), K86 (= K123), G114 (= G153), G115 (= G154), V116 (= V155), D119 (= D158), T139 (= T178), T140 (= T179), D146 (= D185), S147 (≠ A186), F179 (= F218), T182 (= T221), L183 (= L222), Q187 (≠ H226)
Sites not aligning to the query:
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
25% identity, 76% coverage: 83:418/440 of query aligns to 33:351/354 of Q6GGU4
1nvaA Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp (see paper)
25% identity, 54% coverage: 120:358/440 of query aligns to 78:318/380 of 1nvaA
- active site: R127 (= R169), K149 (≠ R191), E191 (= E233), K247 (≠ E289), R257 (≠ E295), N261 (≠ D299), H264 (= H302), H268 (= H306), H280 (= H320)
- binding adenosine-5'-diphosphate: G111 (= G153), G112 (= G154), T136 (= T178), T137 (= T179), F176 (= F218), T179 (= T221), L180 (= L222)
- binding zinc ion: E191 (= E233), H264 (= H302), H280 (= H320)
Sites not aligning to the query:
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
25% identity, 54% coverage: 120:358/440 of query aligns to 79:323/391 of 1nvbB
- active site: R128 (= R169), K150 (≠ R191), E192 (= E233), K248 (vs. gap), E258 (≠ T291), R262 (≠ E295), N266 (≠ D299), H269 (= H302), H273 (= H306), H285 (= H320)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D185), K150 (≠ R191), N160 (= N201), E192 (= E233), K248 (vs. gap), R262 (≠ E295), L265 (≠ Q298), N266 (≠ D299), H269 (= H302), H273 (= H306)
- binding zinc ion: E192 (= E233), H269 (= H302), H285 (= H320)
Sites not aligning to the query:
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
26% identity, 54% coverage: 120:358/440 of query aligns to 81:325/1583 of P07547
Sites not aligning to the query:
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
25% identity, 76% coverage: 83:418/440 of query aligns to 33:351/353 of 1xagA
- active site: R115 (= R169), K136 (≠ R191), E178 (= E233), K221 (≠ Y285), E231 (≠ H288), R235 (≠ N292), N239 (≠ T296), H242 (= H306), H246 (≠ P310), H256 (= H320)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (≠ R191), N146 (= N201), E178 (= E233), K221 (≠ Y285), R235 (≠ N292), L238 (≠ E295), N239 (≠ T296), H242 (= H306), H246 (≠ P310), K314 (≠ Q375)
- binding nicotinamide-adenine-dinucleotide: D39 (= D89), Y41 (≠ T91), V42 (= V92), Y45 (≠ L95), E68 (= E120), K71 (= K123), G99 (= G153), G100 (= G154), A101 (≠ V155), D104 (= D158), T124 (= T178), T125 (= T179), L127 (≠ V181), D130 (= D185), S131 (≠ A186), K136 (≠ R191), K145 (= K200), T166 (= T221), L167 (= L222), Q171 (≠ H226), H256 (= H320)
- binding zinc ion: E178 (= E233), H242 (= H306), H256 (= H320)
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
24% identity, 69% coverage: 78:381/440 of query aligns to 31:329/359 of Q5NFS1
Query Sequence
>WP_009547444.1 NCBI__GCF_000017845.1:WP_009547444.1
MVQAKPLTEKTVSKSNQIIQFNHPVKYRTSEWYTGQGEIVASGDNRSFEVSASYNLKSTV
KLVNEILNPNNPTLAEIYSHRGRCVAIVDLTVDELYGDAIRRYFKYHEIPLELLPCRAWE
SDKTPQTVHNLLAFLGKDGCDVSRNEPVLVIGGGVLSDVAGLACALQHRRTPYIMIGTTV
VAAIDAGPSPRTCTNGSQFKNSMGVYHPPVLTLVDRTFFRTLDTGHIRNGMAEIIKMAVT
DDAILFQLMEEYGTRLLETHFATLEGDEELEKIADEVIYRALFSYMKHEGTNMFETYQDR
PHAYGHTWSPRFEPAAKLMHGHAVSIGMAFGASLATEMGWLSSEDRDRIIALCSSIGLSV
FHPIIEDMDIMLEGQKNMRRKRGEGGLWAPLPTGIGECDFAQEVSSGLLQQAVNNHKTLC
VSLPSGGEGKEMYLSDLGLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory