Comparing WP_009547763.1 NCBI__GCF_000017845.1:WP_009547763.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
46% identity, 94% coverage: 22:416/422 of query aligns to 2:385/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
46% identity, 94% coverage: 22:416/422 of query aligns to 10:393/393 of 2ordA
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
44% identity, 94% coverage: 17:412/422 of query aligns to 6:394/400 of 4addA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
44% identity, 94% coverage: 17:412/422 of query aligns to 6:394/401 of 4adbB
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
43% identity, 92% coverage: 22:409/422 of query aligns to 3:372/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
43% identity, 92% coverage: 22:409/422 of query aligns to 2:371/375 of 2eh6A
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 92% coverage: 23:409/422 of query aligns to 69:449/457 of Q9M8M7
Sites not aligning to the query:
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
40% identity, 95% coverage: 19:418/422 of query aligns to 8:400/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 95% coverage: 19:418/422 of query aligns to 13:405/405 of P40732
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
39% identity, 95% coverage: 19:418/422 of query aligns to 8:395/397 of 4jewA
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
39% identity, 95% coverage: 19:418/422 of query aligns to 2:389/389 of 2pb0A
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
38% identity, 93% coverage: 21:413/422 of query aligns to 2:385/388 of 3nx3A
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
40% identity, 91% coverage: 17:402/422 of query aligns to 5:372/390 of A0QYS9
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
39% identity, 93% coverage: 23:413/422 of query aligns to 10:389/390 of 8ht4B
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
36% identity, 92% coverage: 27:413/422 of query aligns to 24:394/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
36% identity, 92% coverage: 26:413/422 of query aligns to 15:386/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
36% identity, 92% coverage: 26:413/422 of query aligns to 15:386/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
36% identity, 92% coverage: 26:413/422 of query aligns to 15:386/387 of 1vefA
Sites not aligning to the query:
2byjA Ornithine aminotransferase mutant y85i (see paper)
35% identity, 93% coverage: 22:413/422 of query aligns to 15:401/404 of 2byjA
7tedA Human ornithine aminotransferase cocrystallized with its inhibitor, (s,e)-3-amino-4-(fluoromethylene)cyclopent-1-ene-1-carboxylate (see paper)
35% identity, 93% coverage: 22:413/422 of query aligns to 15:401/404 of 7tedA
>WP_009547763.1 NCBI__GCF_000017845.1:WP_009547763.1
MTHTTLTENPAKSFDPQHFDNYVMHTYGRFPIAIDRGEGCRLWDTKGKEYLDFVAGIATC
TLGHGHPALVKTVSEQIQSLHHVSNLYYIPQQGELAQWMIEHSCADKVFFCNSGAEANEA
AIKLIRKYSHTVLDFLEQPVILTAKASFHGRTLATITATGQPKYQQDFEPLMPGFAYVPY
NDIKAIEHAIADIDEGNRRVAAIMLEPLQGEGGVRPGEIEYFLRLRKICDENNILLVFDE
VQVGVGRSGKLWGYENLGVEPDVLTSAKGLAGGIPIGAMMCKEFCNVLTPGTHASTFGGN
PLACAAALTVLKTIEEENILQNVQARGEQLRTRLRAIAQKDPTLFTDVRGWGLINGLEIN
EEMSITSIDIVKAAMEEGLLLAPAGPKVLRFVPPLIVTEEEINQAADLLETAINKVCAAT
VN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory