Comparing WP_009561191.1 NCBI__GCF_000021485.1:WP_009561191.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
55% identity, 100% coverage: 2:291/291 of query aligns to 2:291/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
55% identity, 100% coverage: 2:291/291 of query aligns to 2:291/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
55% identity, 100% coverage: 2:291/291 of query aligns to 2:291/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
55% identity, 100% coverage: 2:291/291 of query aligns to 2:291/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
55% identity, 100% coverage: 2:291/291 of query aligns to 2:291/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
55% identity, 100% coverage: 2:291/291 of query aligns to 2:291/291 of 3pueB
4pfmA Shewanella benthica dhdps with lysine and pyruvate
53% identity, 99% coverage: 1:289/291 of query aligns to 2:291/295 of 4pfmA
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
57% identity, 99% coverage: 1:287/291 of query aligns to 1:287/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
57% identity, 99% coverage: 1:287/291 of query aligns to 1:287/292 of 3puoA
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
54% identity, 99% coverage: 1:288/291 of query aligns to 1:289/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
54% identity, 99% coverage: 1:288/291 of query aligns to 1:289/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
54% identity, 99% coverage: 1:288/291 of query aligns to 2:290/293 of 5t25A
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
53% identity, 99% coverage: 1:288/291 of query aligns to 1:289/292 of 3i7sA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
49% identity, 99% coverage: 1:288/291 of query aligns to 1:288/292 of Q07607
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
47% identity, 99% coverage: 1:288/291 of query aligns to 1:290/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
46% identity, 99% coverage: 1:288/291 of query aligns to 1:290/294 of 4i7wA
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
41% identity, 98% coverage: 4:289/291 of query aligns to 6:292/296 of 4m19A
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
40% identity, 99% coverage: 1:288/291 of query aligns to 1:291/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
40% identity, 99% coverage: 1:288/291 of query aligns to 2:292/295 of 1o5kA
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
41% identity, 98% coverage: 4:289/291 of query aligns to 6:292/296 of 6u01B
>WP_009561191.1 NCBI__GCF_000021485.1:WP_009561191.1
MFHGSMVALVTPMQVDGAIDDVALRELVEWHIAEGTHALVAVGTTGESATLEMREHVAVI
QTVVEQARGRVPVIAGTGANATHEAIELTRAAMEVKADAALLVSPYYNKPTQEGLFQHYS
AIAEHCHFPIILYNVPGRTAGDILPETVARLAPRADIIGIKEASGKVERVAEILALCGDQ
VQVYSGDDGAALAAMALGARGVISVTANAAPRLMARMCDLALAGDFVGARAVNAQLTGLH
RDLFLESNPIPVKWALHEMGRMESVLRLPLTTLSSVHHERLRESLRRAQCI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory