SitesBLAST
Comparing WP_009563248.1 NCBI__GCF_000015985.1:WP_009563248.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
35% identity, 95% coverage: 22:415/415 of query aligns to 28:415/494 of 1tdjA
- active site: K58 (= K52), A83 (= A78), E209 (= E208), S213 (≠ G212), C215 (≠ S214), G237 (= G236), L310 (≠ T308), S311 (= S309)
- binding pyridoxal-5'-phosphate: F57 (≠ Y51), K58 (= K52), N85 (= N80), G184 (= G183), G185 (= G184), G186 (= G185), G187 (= G186), G237 (= G236), E282 (= E282), S311 (= S309), G312 (= G310)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
35% identity, 95% coverage: 22:415/415 of query aligns to 32:419/514 of P04968
- K62 (= K52) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N80) binding
- GGGGL 188:192 (= GGGGL 183:187) binding
- S315 (= S309) binding
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
31% identity, 75% coverage: 11:321/415 of query aligns to 15:321/326 of 2gn2A
- active site: K56 (= K52), A81 (= A78), Q207 (≠ E208), V211 (≠ G212), G213 (≠ S214), G235 (= G236), I308 (≠ T308), S309 (= S309)
- binding cytidine-5'-monophosphate: R51 (≠ P47), T52 (≠ V48), G53 (≠ R49), A114 (≠ K111), D117 (≠ T114), Y118 (≠ F115), N312 (= N312)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
26% identity, 74% coverage: 10:317/415 of query aligns to 10:311/318 of 1wtcA
- active site: K52 (= K52), S77 (≠ A78), E203 (= E208), G207 (= G212), D209 (≠ S214), G231 (= G236), I302 (≠ T308), S303 (= S309)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ P20), K47 (≠ P47), M48 (≠ V48), A109 (= A110), A110 (≠ K111), Y114 (≠ F115)
- binding magnesium ion: E203 (= E208), G207 (= G212), D209 (≠ S214)
- binding pyridoxal-5'-phosphate: F51 (≠ Y51), K52 (= K52), N79 (= N80), G178 (≠ V182), G179 (= G183), G180 (= G184), G181 (= G185), G231 (= G236), E276 (= E282), T278 (≠ A284), S303 (= S309)
1v71A Crystal structure of s.Pombe serine racemase
26% identity, 74% coverage: 10:317/415 of query aligns to 10:311/318 of 1v71A
- active site: K52 (= K52), S77 (≠ A78), E203 (= E208), G207 (= G212), D209 (≠ S214), G231 (= G236), I302 (≠ T308), S303 (= S309)
- binding magnesium ion: E203 (= E208), G207 (= G212), D209 (≠ S214)
- binding pyridoxal-5'-phosphate: F51 (≠ Y51), K52 (= K52), N79 (= N80), G178 (≠ V182), G179 (= G183), G180 (= G184), G181 (= G185), G231 (= G236), E276 (= E282), T278 (≠ A284), S303 (= S309), G304 (= G310)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
26% identity, 74% coverage: 10:317/415 of query aligns to 11:312/319 of 2zr8A
- active site: K53 (= K52), S78 (≠ A78), E204 (= E208), G208 (= G212), D210 (≠ S214), G232 (= G236), I303 (≠ T308), S304 (= S309)
- binding magnesium ion: E204 (= E208), G208 (= G212), D210 (≠ S214)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y51), K53 (= K52), S77 (= S77), S78 (≠ A78), N80 (= N80), H81 (= H81), P147 (= P150), G179 (≠ V182), G180 (= G183), G181 (= G184), G182 (= G185), G232 (= G236), E277 (= E282), T279 (≠ A284), S304 (= S309)
- binding serine: S78 (≠ A78), R129 (≠ T132), D231 (= D235), G232 (= G236), A233 (= A237), Q234 (≠ A238), T235 (≠ V239)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
26% identity, 74% coverage: 10:317/415 of query aligns to 11:312/319 of 2zpuA
- active site: K53 (= K52), S78 (≠ A78), E204 (= E208), G208 (= G212), D210 (≠ S214), G232 (= G236), I303 (≠ T308), S304 (= S309)
- binding magnesium ion: E204 (= E208), G208 (= G212), D210 (≠ S214)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (≠ Y51), K53 (= K52), S77 (= S77), S78 (≠ A78), N80 (= N80), H81 (= H81), P147 (= P150), G179 (≠ V182), G180 (= G183), G181 (= G184), G182 (= G185), G232 (= G236), E277 (= E282), T279 (≠ A284), S304 (= S309)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 74% coverage: 10:317/415 of query aligns to 15:316/323 of O59791
- S82 (≠ A78) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
31% identity, 74% coverage: 9:317/415 of query aligns to 11:312/319 of A4F2N8
- K53 (= K52) mutation to A: Loss of enzymatic activity.
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
34% identity, 66% coverage: 43:315/415 of query aligns to 41:306/308 of 1ve5A
- active site: K50 (= K52), S56 (≠ T58), S72 (≠ A78), E200 (= E208), A204 (≠ G212), D206 (≠ S214), G229 (= G236), L299 (≠ T308), S300 (= S309)
- binding calcium ion: E200 (= E208), A204 (≠ G212), D206 (≠ S214)
- binding pyridoxal-5'-phosphate: F49 (≠ Y51), K50 (= K52), N74 (= N80), G175 (= G183), G176 (= G184), G177 (= G185), G178 (= G186), E274 (= E282), T276 (≠ A284), S300 (= S309), G301 (= G310)
Q8VBT2 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Mus musculus (Mouse)
31% identity, 74% coverage: 14:322/415 of query aligns to 3:317/327 of Q8VBT2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
26% identity, 72% coverage: 21:320/415 of query aligns to 37:334/339 of Q7XSN8
- E219 (= E208) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ S214) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
1pwhA Rat liver l-serine dehydratase- complex with pyridoxyl-(o-methyl- serine)-5-monophosphate (see paper)
31% identity, 75% coverage: 14:324/415 of query aligns to 3:319/327 of 1pwhA
- active site: K41 (= K52), A65 (= A78), E194 (= E208), A198 (≠ G212), S200 (= S214), A222 (≠ G236), A269 (= A284), C303 (≠ T308)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-o-methyl-l-serine: F40 (≠ Y51), K41 (= K52), S64 (= S77), A65 (= A78), N67 (= N80), A68 (≠ H81), F136 (= F151), G168 (= G183), G169 (= G184), G170 (= G185), G171 (= G186), A222 (≠ G236), G224 (≠ A238), C303 (≠ T308), G304 (≠ S309)
6zspAAA serine racemase bound to atp and malonate. (see paper)
26% identity, 73% coverage: 15:315/415 of query aligns to 16:309/320 of 6zspAAA
- active site: K53 (= K52), S74 (≠ A78), E200 (= E208), A204 (≠ G212), D206 (≠ S214), G229 (= G236), L302 (≠ T308), S303 (= S309)
- binding adenosine-5'-triphosphate: S28 (≠ N27), S29 (≠ D28), I30 (≠ H29), K48 (≠ P47), T49 (≠ V48), Q79 (= Q83), Y111 (≠ F115), E266 (≠ L274), R267 (≠ N275), K269 (≠ E277), N306 (= N312)
- binding magnesium ion: E200 (= E208), A204 (≠ G212), D206 (≠ S214)
- binding malonate ion: K53 (= K52), S73 (= S77), S74 (≠ A78), N76 (= N80), H77 (= H81), R125 (≠ T132), G229 (= G236), S232 (≠ A240)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
27% identity, 73% coverage: 15:315/415 of query aligns to 16:316/322 of 7nbgAAA
- active site: K53 (= K52), S81 (≠ A78), E207 (= E208), A211 (≠ G212), D213 (≠ S214), G236 (= G236), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (≠ G212), D213 (≠ S214)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ A237), T282 (≠ A284), S310 (= S309), G311 (= G310)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A78), G85 (≠ A82), Q86 (= Q83), I101 (= I98), K111 (= K108), I115 (≠ T112), Y118 (≠ F115)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
27% identity, 73% coverage: 15:315/415 of query aligns to 16:316/320 of 7nbhAAA
- active site: K53 (= K52), S81 (≠ A78), E207 (= E208), A211 (≠ G212), D213 (≠ S214), G236 (= G236), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (≠ G212), D213 (≠ S214)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A78), G85 (≠ A82), Q86 (= Q83), K111 (= K108), I115 (≠ T112), Y118 (≠ F115), D235 (= D235), P281 (= P283), N313 (= N312), V314 (≠ F313), D315 (= D314)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
27% identity, 73% coverage: 15:315/415 of query aligns to 16:316/323 of 7nbfAAA
- active site: K53 (= K52), S81 (≠ A78), E207 (= E208), A211 (≠ G212), D213 (≠ S214), G236 (= G236), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (≠ G212), D213 (≠ S214)
- binding magnesium ion: N244 (≠ L245)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ A237), T282 (≠ A284), S310 (= S309), G311 (= G310)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ P20), L22 (≠ E21), T23 (= T22), P24 (= P23), L26 (≠ Q25), T27 (≠ R26), F46 (≠ L45)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
27% identity, 73% coverage: 15:315/415 of query aligns to 16:316/323 of 7nbdAAA
- active site: K53 (= K52), S81 (≠ A78), E207 (= E208), A211 (≠ G212), D213 (≠ S214), G236 (= G236), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (≠ G212), D213 (≠ S214)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ M273), L278 (≠ V280), V314 (≠ F313), L316 (≠ F315)
- binding magnesium ion: N244 (≠ L245)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ A237), E280 (= E282), T282 (≠ A284), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
27% identity, 73% coverage: 15:315/415 of query aligns to 16:316/323 of 7nbcCCC
- active site: K53 (= K52), S81 (≠ A78), E207 (= E208), A211 (≠ G212), D213 (≠ S214), G236 (= G236), L309 (≠ T308), S310 (= S309)
- binding biphenyl-4-ylacetic acid: T78 (≠ C75), H79 (≠ A76), H84 (= H81), V148 (≠ L148), H149 (≠ A149), P150 (= P150)
- binding calcium ion: E207 (= E208), A211 (≠ G212), D213 (≠ S214)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ A237), T282 (≠ A284), S310 (= S309), G311 (= G310)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
27% identity, 73% coverage: 15:315/415 of query aligns to 16:316/323 of 7nbcAAA
- active site: K53 (= K52), S81 (≠ A78), E207 (= E208), A211 (≠ G212), D213 (≠ S214), G236 (= G236), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (= E208), A211 (≠ G212), D213 (≠ S214)
- binding magnesium ion: N244 (≠ L245)
- binding pyridoxal-5'-phosphate: F52 (≠ Y51), K53 (= K52), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ A237), T282 (≠ A284), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
Query Sequence
>WP_009563248.1 NCBI__GCF_000015985.1:WP_009563248.1
MTQFARNARAATRALRDLFPETPLQRNDHLSARYGADIWLKREDLTPVRSYKLRGAFTAM
RKVRDARPDQRSFVCASAGNHAQGVAYACRHFGVKGTIFMPVTTPQQKIAKTRTFGGEAV
EIVLTGDYFDQTLAAAQAWCAEQKAHFLAPFDDPDVIEGQASVGVELLEQLGRAPDLVVL
PVGGGGLASGVTAFLRSEAPETDFRFVEPAGGASLLAALEAGGPTALPRVNSFVDGAAVA
RLGQLPFSMLDWVRPDQVHLAPEDRICITMLEMLNVEGIVLEPAGALSVDVLPELADRIR
GRTVVCVTSGGNFDFERLPEVKERAQRYSGLKKYFILRMPQRPGALREFLMMLGPDDDIA
RFEYLKKSARNFGSVLIGIETREAGNFARLTAVMEEAGLNYRDITGDDALAEFLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory