Comparing WP_009779324.1 NCBI__GCF_000152985.1:WP_009779324.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
4eayA Crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate (see paper)
55% identity, 98% coverage: 1:383/389 of query aligns to 3:390/395 of 4eayA
4eacC Crystal structure of mannonate dehydratase from escherichia coli strain k12 (see paper)
55% identity, 98% coverage: 1:383/389 of query aligns to 3:390/396 of 4eacC
3dbnA Crystal structure of the streptoccocus suis serotype2 d-mannonate dehydratase in complex with its substrate (see paper)
36% identity, 97% coverage: 1:378/389 of query aligns to 3:328/349 of 3dbnA
3bdkA Crystal structure of streptococcus suis mannonate dehydratase complexed with substrate analogue
36% identity, 97% coverage: 1:378/389 of query aligns to 3:328/349 of 3bdkA
>WP_009779324.1 NCBI__GCF_000152985.1:WP_009779324.1
MIQTMRWYGHKDLVTLQDIRQAGATGVVHAMHEITNGEVWSLEALQQRKQEIEAAGLDWK
VVESLPVTEPIKTRSGDFQKHIDNYKQSLINLGKIGVEVVCYNFMPVLDWTRTQLAYPLE
NGATALRFDWAHLAAFDCFMLKRKDAEKEYSEAILAEAKHFFESATTEEKQQLENAIIAG
LPGAEEGYDLQGLQTAIDKYAAIDEIQAQEHLKLFLNEIIPVAETAGIAMAIHPDDPPHP
FFGLPRIMSKASDIKRLLEDNASAFNGVTFCTGSFGARADNDLVQMINDYGSHIHFIHLR
STKRDATGNFFEDNHLEGDVPMPAVVHALLEVEKSRGKQLPMRPDHGHQMLDDLKKPLAH
PGYTAIGRLKGLAELRGVIAGIEFMQDKN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory