Comparing WP_010173582.1 NCBI__GCF_000171615.1:WP_010173582.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1sazA Membership in the askha superfamily: enzymological properties and crystal structure of butyrate kinase 2 from thermotoga maritima (see paper)
57% identity, 98% coverage: 5:362/367 of query aligns to 2:360/375 of 1sazA
4ijnA Crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate (see paper)
34% identity, 42% coverage: 156:308/367 of query aligns to 160:312/376 of 4ijnA
Sites not aligning to the query:
P38502 Acetate kinase; Acetokinase; EC 2.7.2.1 from Methanosarcina thermophila (see 5 papers)
33% identity, 43% coverage: 152:308/367 of query aligns to 175:332/408 of P38502
Sites not aligning to the query:
1tuuA Acetate kinase crystallized with atpgs (see paper)
33% identity, 43% coverage: 152:308/367 of query aligns to 175:332/399 of 1tuuA
Sites not aligning to the query:
1tuuB Acetate kinase crystallized with atpgs (see paper)
33% identity, 43% coverage: 152:308/367 of query aligns to 175:332/398 of 1tuuB
Sites not aligning to the query:
4iz9A Crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese (see paper)
26% identity, 94% coverage: 6:350/367 of query aligns to 5:381/381 of 4iz9A
4fwsA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with ctp (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 4fwsA
Sites not aligning to the query:
4fwrA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with cmp (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 4fwrA
Sites not aligning to the query:
4fwqA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gtp (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 4fwqA
Sites not aligning to the query:
4fwpA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gdp (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 4fwpA
Sites not aligning to the query:
4fwoA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gmp (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 4fwoA
Sites not aligning to the query:
4fwnA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with adenosine tetraphosphate (ap4) (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 4fwnA
Sites not aligning to the query:
4fwmA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with atp (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 4fwmA
Sites not aligning to the query:
4fwkA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with amp (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 4fwkA
Sites not aligning to the query:
2e1zA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with diadenosine tetraphosphate (ap4a) obtained after co- crystallization with atp (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 2e1zA
Sites not aligning to the query:
1x3nA Crystal structure of amppnp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 1x3nA
Sites not aligning to the query:
1x3mA Crystal structure of adp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
26% identity, 47% coverage: 148:319/367 of query aligns to 163:335/394 of 1x3mA
Sites not aligning to the query:
9dv9A The amp-bound structure of acka from treponema vincentii (see paper)
26% identity, 56% coverage: 152:357/367 of query aligns to 179:386/453 of 9dv9A
7fj9A Kpacka (pduw) with amppnp complex structure
28% identity, 43% coverage: 152:308/367 of query aligns to 173:330/395 of 7fj9A
Sites not aligning to the query:
7fj8A Kpacka (pduw) with amp complex structure
28% identity, 43% coverage: 152:308/367 of query aligns to 173:330/395 of 7fj8A
Sites not aligning to the query:
>WP_010173582.1 NCBI__GCF_000171615.1:WP_010173582.1
MQEQFRILVINPGSTSTKIGVFDNDDVVFEKTLRHDSDEINQYPSIIDQYEFRKTTILHA
LDEEGINVSKLSAVCGRGGLLRPIEGGTYEVNEQMLQDLRKGYSGQHASNLGGIIANEIA
GALNIPSFIVDPVVVDELSDVARVSGFSLIERKSIFHALNQKAVARRVAKELNKSYEELN
LIVTHMGGGITVGAHKGGKVIDVNNGLHGDGPFSPERAGTVPAGDLVDLCFSGDFYREEI
MKKLVGQGGLVGYLGTNDAIQVEKRIEKGDEKAKLVYDAMAYQVAKEIGSASAVLQGQVD
AIILTGGLAYGKDFVSTIVQQVSWIADVMVKPGENELQALAEGALRVLTGEEKAKVYPNQ
VKTGLNV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory