SitesBLAST
Comparing WP_010438864.1 NCBI__GCF_000192475.1:WP_010438864.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
4lhmA Thymidine phosphorylase from e.Coli with 3'-azido-3'-deoxythymidine (see paper)
48% identity, 99% coverage: 3:434/435 of query aligns to 4:439/440 of 4lhmA
- active site: D83 (= D79), K84 (= K80), H85 (= H81), S86 (= S82), T123 (= T119), D164 (= D160), R171 (= R167), S186 (= S182), K190 (= K186), K191 (= K187)
- binding 3'-azido-3'-deoxythymidine: T87 (= T83), Y168 (= Y164), R171 (= R167), V177 (= V173), S186 (= S182), K190 (= K186), F210 (= F206)
- binding sulfate ion: K84 (= K80), S86 (= S82), S95 (= S91), S113 (= S109), T123 (= T119), A175 (= A171), V177 (= V173), D178 (≠ E174), R234 (= R230), R257 (≠ A253), K288 (≠ G283), H403 (= H398), R437 (= R432), S439 (= S434)
4eadA Thymidine phosphorylase from e.Coli with 3'-azido-2'-fluoro- dideoxyuridine
48% identity, 99% coverage: 3:434/435 of query aligns to 4:439/440 of 4eadA
- active site: D83 (= D79), K84 (= K80), H85 (= H81), S86 (= S82), T123 (= T119), D164 (= D160), R171 (= R167), S186 (= S182), K190 (= K186), K191 (= K187)
- binding 2',3'-dideoxy-2'-fluoro-3'-triaza-1,2-dien-2-ium-1-yluridine: T87 (= T83), Y168 (= Y164), R171 (= R167), V177 (= V173), S186 (= S182), K190 (= K186), F210 (= F206)
4yyyB X-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with uridine (see paper)
48% identity, 99% coverage: 3:434/435 of query aligns to 4:439/440 of 4yyyB
- active site: D83 (= D79), K84 (= K80), H85 (= H81), S86 (= S82), T123 (= T119), D164 (= D160), R171 (= R167), S186 (= S182), K190 (= K186), K191 (= K187)
- binding uridine: T87 (= T83), G118 (= G114), Y168 (= Y164), R171 (= R167), S186 (= S182), I187 (= I183), K190 (= K186), S248 (≠ P244), Q261 (≠ K257), Y267 (≠ Q263)
4yekA X-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with thymidine (see paper)
48% identity, 99% coverage: 3:434/435 of query aligns to 4:439/440 of 4yekA
- active site: D83 (= D79), K84 (= K80), H85 (= H81), S86 (= S82), T123 (= T119), D164 (= D160), R171 (= R167), S186 (= S182), K190 (= K186), K191 (= K187)
- binding thymidine: T87 (= T83), Y168 (= Y164), R171 (= R167), S186 (= S182), F210 (= F206), S248 (≠ P244), Q261 (≠ K257), Y267 (≠ Q263), T384 (≠ S379), D385 (= D380)
5ey3A X-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate
48% identity, 99% coverage: 3:434/435 of query aligns to 6:441/442 of 5ey3A
- active site: D85 (= D79), K86 (= K80), H87 (= H81), S88 (= S82), T125 (= T119), D166 (= D160), R173 (= R167), S188 (= S182), K192 (= K186), K193 (= K187)
- binding 4-amino-1-beta-d-ribofuranosyl-2(1h)-pyrimidinone: R117 (= R111), E130 (= E124)
1brwB The crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation (see paper)
45% identity, 98% coverage: 6:433/435 of query aligns to 6:432/433 of 1brwB
- active site: D80 (= D79), K81 (= K80), H82 (= H81), S83 (= S82), T120 (= T119), D161 (= D160), R168 (= R167), S183 (= S182), K187 (= K186), K188 (= K187)
- binding calcium ion: G88 (= G87), L243 (= L242), A246 (= A245), E255 (= E254)
- binding phosphate ion: H82 (= H81), S83 (= S82), T92 (≠ S91), K108 (≠ M107), S110 (= S109), T120 (= T119)
- binding uracil: H82 (= H81), T84 (= T83), L114 (= L113), Y165 (= Y164), I180 (= I179), S183 (= S182), I184 (= I183)
1brwA The crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation (see paper)
45% identity, 98% coverage: 6:433/435 of query aligns to 6:432/433 of 1brwA
- active site: H82 (= H81), D161 (= D160), R168 (= R167), S183 (= S182), K187 (= K186)
- binding calcium ion: G88 (= G87), T90 (≠ C89), L243 (= L242), A246 (= A245), E255 (= E254)
- binding phosphate ion: K81 (= K80), H82 (= H81), S83 (= S82), T92 (≠ S91), K108 (≠ M107)
5olnB X-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis at 1.88 a (see paper)
42% identity, 99% coverage: 6:434/435 of query aligns to 7:433/434 of 5olnB
7m7kB Crystal structure of uridine bound to geobacillus thermoglucosidasius pyrimidine nucleoside phosphorylase pynp
42% identity, 99% coverage: 6:434/435 of query aligns to 5:432/432 of 7m7kB
P77836 Pyrimidine-nucleoside phosphorylase; PYNP; Py-NPase; EC 2.4.2.2 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
41% identity, 99% coverage: 6:434/435 of query aligns to 6:433/433 of P77836
- KHS 81:83 (= KHS 80:82) binding phosphate
- G88 (= G87) binding K(+)
- T90 (≠ C89) binding K(+)
- T92 (≠ S91) binding phosphate
- KMS 108:110 (≠ MIS 107:109) binding phosphate
- T120 (= T119) binding phosphate
- R168 (= R167) binding substrate
- K187 (= K186) binding substrate
- L243 (= L242) binding K(+)
- A246 (= A245) binding K(+)
- E255 (= E254) binding K(+)
2j0fA Structural basis for non-competitive product inhibition in human thymidine phosphorylase: implication for drug design (see paper)
40% identity, 96% coverage: 17:433/435 of query aligns to 17:444/446 of 2j0fA
- active site: D81 (= D79), K82 (= K80), H83 (= H81), S84 (= S82), T121 (= T119), D162 (= D160), R169 (= R167), S184 (= S182), K188 (= K186), K189 (= K187)
- binding thymine: H83 (= H81), S84 (= S82), T85 (= T83), L115 (= L113), Y166 (= Y164), R169 (= R167), I181 (= I179), S184 (= S182), K188 (= K186)
2wk6A Structural features of native human thymidine phosphorylase and in complex with 5-iodouracil (see paper)
40% identity, 96% coverage: 17:433/435 of query aligns to 16:443/446 of 2wk6A
- active site: D80 (= D79), K81 (= K80), H82 (= H81), S83 (= S82), T120 (= T119), D161 (= D160), R168 (= R167), S183 (= S182), K187 (= K186), K188 (= K187)
- binding 5-iodouracil: H82 (= H81), T84 (= T83), L114 (= L113), Y165 (= Y164), R168 (= R167), I180 (= I179), S183 (= S182), I184 (= I183), K187 (= K186)
P19971 Thymidine phosphorylase; TP; Gliostatin; Platelet-derived endothelial cell growth factor; PD-ECGF; TdRPase; EC 2.4.2.4 from Homo sapiens (Human) (see 3 papers)
40% identity, 96% coverage: 17:433/435 of query aligns to 50:477/482 of P19971
- Y199 (= Y164) mutation to A: Abolishes catalytic activity.; mutation to F: Reduced catalytic activity.; mutation to L: Reduced catalytic activity.
- S471 (≠ P427) to L: in dbSNP:rs11479
1uouA Crystal structure of human thymidine phosphorylase in complex with a small molecule inhibitor (see paper)
40% identity, 94% coverage: 17:426/435 of query aligns to 18:428/438 of 1uouA
- active site: D82 (= D79), K83 (= K80), H84 (= H81), S85 (= S82), T122 (= T119), D163 (= D160), R170 (= R167), S185 (= S182), K189 (= K186), K190 (= K187)
- binding 5-chloro-6-(1-(2-iminopyrrolidinyl) methyl) uracil: H84 (= H81), S85 (= S82), T86 (= T83), L116 (= L113), Y167 (= Y164), R170 (= R167), I182 (= I179), S185 (= S182), K189 (= K186)
Q5JCX3 AMP phosphorylase; AMPpase; Nucleoside monophosphate phosphorylase; NMP phosphorylase; EC 2.4.2.57 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
29% identity, 94% coverage: 7:413/435 of query aligns to 91:483/503 of Q5JCX3
- G168 (= G85) binding AMP
- SRAITS 194:199 (≠ GRGLGH 110:115) binding AMP
- T203 (= T119) binding AMP
- D256 (= D177) mutation D->N,A: Almost complete loss of activity.
- S264 (= S182) binding AMP
- K288 (≠ F206) binding AMP; mutation to A: Almost complete loss of activity.
4ga6A Crystal structure of amp phosphorylasE C-terminal deletion mutant in complex with substrates (see paper)
29% identity, 94% coverage: 7:413/435 of query aligns to 91:483/493 of 4ga6A
- active site: D162 (= D79), V163 (≠ K80), H164 (= H81), S165 (= S82), T203 (= T119), D243 (= D160), A249 (≠ V173), S264 (= S182), K268 (= K186), K269 (= K187)
- binding adenosine monophosphate: H164 (= H81), S165 (= S82), I166 (≠ T83), S194 (≠ G110), A196 (≠ G112), I197 (≠ L113), T198 (≠ G114), S199 (≠ H115), T203 (= T119), D256 (= D177), M261 (≠ I179), S264 (= S182), K288 (≠ F206)
4ga4A Crystal structure of amp phosphorylase n-terminal deletion mutant (see paper)
29% identity, 94% coverage: 7:413/435 of query aligns to 7:399/418 of 4ga4A
- active site: D78 (= D79), V79 (≠ K80), H80 (= H81), S81 (= S82), T119 (= T119), D159 (= D160), A165 (≠ V173), S180 (= S182), K184 (= K186), K185 (= K187)
- binding phosphate ion: H80 (= H81), S81 (= S82), N91 (≠ S91)
Query Sequence
>WP_010438864.1 NCBI__GCF_000192475.1:WP_010438864.1
MDARSIIAKLRRNEIPTSAELHWFAQGLADGGVSDAQAGAFAMAVCMGGLGAQGRADLTV
AMRDSGEVLNWDVDGPVIDKHSTGGVGDCVSLVLAPALAECGAYVPMISGRGLGHTGGTL
DKLEAIPGVTTQIGQTRLAQILNETGAAIVGATGQIAPADKRLYAIRDVTATVESLDLIT
ASILSKKLAASPDALVLDVKVGSGAFMKTLDEARKLARALTETANTAGCRTSAVITDMNQ
PLAPALGNALEVAEVMKVMTSGQSSPLAEISAELGGVLMADAGMCASAEEGRARIAEVIR
DGRAAERFGRMMAAVGGPVHFVDTWARFLPEANVIQEVPAPRDGYISAIDGEALGLAVVA
LGGGRQVESDEIDPAVGLSDILRLGQHVQKGAPLAVVHAAREDAARLASEAVLNAVALGD
APVEQPPHIHERISA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory