SitesBLAST
Comparing WP_010439643.1 NCBI__GCF_000192475.1:WP_010439643.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4uqvG Methanococcus jannaschii serine hydroxymethyl-transferase in complex with plp (see paper)
33% identity, 88% coverage: 50:433/435 of query aligns to 23:415/429 of 4uqvG
- active site: Y50 (≠ P77), E52 (≠ L79), D196 (= D223), S223 (= S250), K226 (= K253), Q232 (≠ A259)
- binding pyridoxal-5'-phosphate: G93 (= G120), V94 (≠ A121), H121 (= H148), A198 (= A225), H199 (= H226), S223 (= S250), H225 (≠ Y252), K226 (= K253)
4bhdB Methanococcus jannaschii serine hydroxymethyl-transferase, apo form (see paper)
33% identity, 80% coverage: 88:433/435 of query aligns to 46:381/395 of 4bhdB
Sites not aligning to the query:
Q5SI56 Serine hydroxymethyltransferase; SHMT; Serine methylase; EC 2.1.2.1 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
31% identity, 87% coverage: 34:412/435 of query aligns to 10:385/407 of Q5SI56
- Y51 (≠ P77) binding pyridoxal 5'-phosphate
- GS 94:95 (≠ GA 120:121) binding pyridoxal 5'-phosphate
- S172 (= S198) binding pyridoxal 5'-phosphate
- H200 (= H226) binding pyridoxal 5'-phosphate
- H225 (≠ Y252) binding pyridoxal 5'-phosphate
- K226 (= K253) modified: N6-(pyridoxal phosphate)lysine
- G258 (≠ N285) binding pyridoxal 5'-phosphate
9bowA X-ray structure of thermus thermophilus serine hydroxymethyltransferase with plp-l-ser external aldimine and 5- formyltetrahydrofolate (folinic acid) (see paper)
31% identity, 87% coverage: 34:412/435 of query aligns to 5:380/402 of 9bowA
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: E48 (≠ L79), Y55 (= Y86), F247 (= F279)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: Y46 (≠ P77), E48 (≠ L79), Y56 (≠ E87), G252 (≠ A284)
- binding serine: S26 (≠ A57), H195 (= H226), K221 (= K253), R353 (= R385)
9bohA Serine hydroxymethyltransferase (see paper)
31% identity, 87% coverage: 34:412/435 of query aligns to 5:380/402 of 9bohA
8suiB Joint x-ray/neutron structure of thermus thermophilus serine hydroxymethyltransferase (tthshmt) in internal aldimine state with l- ser bound in a pre-michalis complex (see paper)
31% identity, 87% coverage: 34:412/435 of query aligns to 5:380/402 of 8suiB
8ssyA Room-temperature x-ray structure of thermus thermophilus serine hydroxymethyltransferase (shmt) bound with d-ser in a pseudo- michaelis complex (see paper)
31% identity, 87% coverage: 34:412/435 of query aligns to 5:380/402 of 8ssyA
2dkjA Crystal structure of t.Th.Hb8 serine hydroxymethyltransferase
31% identity, 87% coverage: 34:412/435 of query aligns to 5:380/402 of 2dkjA
- active site: Y46 (≠ P77), E48 (≠ L79), D192 (= D223), T218 (≠ S250), K221 (= K253), R227 (≠ A259)
- binding pyridoxal-5'-phosphate: S88 (= S119), G89 (= G120), S90 (≠ A121), H117 (= H148), S167 (= S198), D192 (= D223), A194 (= A225), H220 (≠ Y252), K221 (= K253)
6ti4A Shmt from streptococcus thermophilus tyr55ser variant in complex with plp/d-serine/lys230 gem diamine complex
32% identity, 82% coverage: 57:412/435 of query aligns to 29:384/410 of 6ti4A
- active site: S49 (≠ P77), E51 (≠ L79), D195 (= D223), T221 (≠ S250), K224 (= K253), R230 (≠ A259)
- binding magnesium ion: A50 (≠ S78), E51 (≠ L79), Y58 (= Y86), Y59 (≠ E87)
- binding (2~{R})-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]-3-oxidanyl-propanoic acid: E51 (≠ L79), Y59 (≠ E87), S91 (= S119), G92 (= G120), S93 (≠ A121), H120 (= H148), S170 (= S198), D195 (= D223), A197 (= A225), H198 (= H226), K224 (= K253), G255 (≠ A284), R357 (= R385)
6ti3A Apo-shmt from streptococcus thermophilus tyr55ser variant in complex with d-threonine
32% identity, 82% coverage: 57:412/435 of query aligns to 29:384/410 of 6ti3A
- active site: S49 (≠ P77), E51 (≠ L79), D195 (= D223), T221 (≠ S250), K224 (= K253), R230 (≠ A259)
- binding d-threonine: S91 (= S119), G92 (= G120), S93 (≠ A121), H223 (≠ Y252), G255 (≠ A284), G256 (vs. gap)
6tghC Shmt from streptococcus thermophilus tyr55thr variant in complex with d-serine both as external aldimine and as non-covalent complex
33% identity, 81% coverage: 59:412/435 of query aligns to 31:384/410 of 6tghC
- active site: T49 (≠ P77), E51 (≠ L79), D195 (= D223), T221 (≠ S250), K224 (= K253), R230 (≠ A259)
- binding d-serine: H198 (= H226), R357 (= R385)
- binding L-Serine, N-[[3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]-4-pyridinyl]methylene]: E51 (≠ L79), G255 (≠ A284)
- binding pyridoxal-5'-phosphate: S91 (= S119), G92 (= G120), S93 (≠ A121), H120 (= H148), D195 (= D223), A197 (= A225), H198 (= H226), T221 (≠ S250), K224 (= K253)
Sites not aligning to the query:
6tghA Shmt from streptococcus thermophilus tyr55thr variant in complex with d-serine both as external aldimine and as non-covalent complex
33% identity, 81% coverage: 59:412/435 of query aligns to 31:384/410 of 6tghA
- active site: T49 (≠ P77), E51 (≠ L79), D195 (= D223), T221 (≠ S250), K224 (= K253), R230 (≠ A259)
- binding d-serine: E51 (≠ L79), Y59 (≠ E87)
- binding L-Serine, N-[[3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]-4-pyridinyl]methylene]: S91 (= S119), G92 (= G120), S93 (≠ A121), H120 (= H148), S170 (= S198), D195 (= D223), A197 (= A225), H198 (= H226), K224 (= K253), R357 (= R385)
Sites not aligning to the query:
4wxgA Crystal structure of l-serine hydroxymethyltransferase in complex with a mixture of l-threonine and glycine (see paper)
32% identity, 82% coverage: 57:412/435 of query aligns to 29:384/410 of 4wxgA
- active site: T43 (≠ S71), L45 (≠ I73), G189 (= G217), A215 (= A244), T218 (≠ M247), R230 (≠ A259)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-threonine: S29 (≠ A57), Y49 (≠ P77), E51 (≠ L79), Y59 (≠ E87), S91 (= S119), G92 (= G120), S93 (≠ A121), H120 (= H148), S170 (= S198), D195 (= D223), A197 (= A225), H198 (= H226), T221 (≠ S250), K224 (= K253), G255 (≠ A284), R357 (= R385)
4wxfA Crystal structure of l-serine hydroxymethyltransferase in complex with glycine (see paper)
32% identity, 82% coverage: 57:412/435 of query aligns to 29:384/410 of 4wxfA
- active site: T43 (≠ S71), L45 (≠ I73), G189 (= G217), A215 (= A244), T218 (≠ M247), R230 (≠ A259)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: S29 (≠ A57), Y49 (≠ P77), Y59 (≠ E87), S91 (= S119), G92 (= G120), S93 (≠ A121), H120 (= H148), S170 (= S198), D195 (= D223), A197 (= A225), H198 (= H226), H223 (≠ Y252), K224 (= K253), G255 (≠ A284), R357 (= R385)
9j4gA Serine hydroxymethyltransferase (see paper)
33% identity, 86% coverage: 41:412/435 of query aligns to 17:385/411 of 9j4gA
- binding (+)-shin-2: E52 (≠ L79), Y59 (= Y86), L116 (≠ G143), G120 (= G147), H121 (= H148), L122 (≠ V149), K341 (≠ G369), N342 (≠ I370), S343 (≠ G371), P351 (≠ E378)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: S30 (≠ A57), Y50 (≠ P77), E52 (≠ L79), S92 (= S119), G93 (= G120), S94 (≠ A121), H121 (= H148), S171 (= S198), D196 (= D223), A198 (= A225), H199 (= H226), K225 (= K253), G256 (≠ A284), R358 (= R385)
7x5nA Crystal structure of e. Faecium shmt in complex with (+)-shin-1 and plp-ser (see paper)
33% identity, 86% coverage: 41:412/435 of query aligns to 16:384/409 of 7x5nA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: E51 (≠ L79), Y58 (= Y86), Y59 (≠ E87), L115 (≠ G143), G119 (= G147), H120 (= H148), L121 (≠ V149), K340 (≠ G369), N341 (≠ I370), S342 (≠ G371), P350 (≠ E378), F351 (≠ G379), R357 (= R385)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: S29 (≠ A57), Y49 (≠ P77), E51 (≠ L79), Y59 (≠ E87), S91 (= S119), G92 (= G120), S93 (≠ A121), H120 (= H148), S170 (= S198), D195 (= D223), A197 (= A225), H198 (= H226), K224 (= K253), R357 (= R385)
7v3dA Complex structure of serine hydroxymethyltransferase from enterococcus faecium and its inhibitor (see paper)
33% identity, 86% coverage: 41:412/435 of query aligns to 16:384/409 of 7v3dA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: E51 (≠ L79), Y58 (= Y86), L115 (≠ G143), G119 (= G147), H120 (= H148), L121 (≠ V149), K340 (≠ G369), S342 (≠ G371), P350 (≠ E378), F351 (≠ G379), R357 (= R385)
- binding pyridoxal-5'-phosphate: Y49 (≠ P77), S91 (= S119), G92 (= G120), S93 (≠ A121), H120 (= H148), S170 (= S198), D195 (= D223), A197 (= A225), K224 (= K253), G255 (≠ A284)
7x5oB Crystal structure of e. Faecium shmt in complex with me-thf and plp- gly (see paper)
33% identity, 86% coverage: 41:412/435 of query aligns to 17:385/412 of 7x5oB
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: S30 (≠ A57), Y50 (≠ P77), Y60 (≠ E87), S92 (= S119), G93 (= G120), S94 (≠ A121), H121 (= H148), S171 (= S198), D196 (= D223), A198 (= A225), H199 (= H226), K225 (= K253), R358 (= R385)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: E52 (≠ L79), Y59 (= Y86), L116 (≠ G143), G119 (= G146), G120 (= G147), H121 (= H148), S171 (= S198), P252 (= P280), N342 (≠ I370), P351 (≠ E378)
2vmyA Crystal structure of f351gbsshmt in complex with gly and fthf (see paper)
31% identity, 87% coverage: 42:420/435 of query aligns to 16:395/405 of 2vmyA
- active site: Y51 (≠ P77), E53 (≠ L79), D197 (= D223), T223 (≠ S250), K226 (= K253), R232 (≠ A259)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: E53 (≠ L79), Y60 (= Y86), Y61 (≠ E87), L117 (≠ G143), G121 (= G147), H122 (= H148), L123 (≠ V149), S172 (= S198), K248 (≠ A276), F251 (= F279), N341 (≠ I370), S349 (≠ E378), P350 (vs. gap), G351 (= G379), R357 (= R385)
- binding glycine: S31 (≠ A57), Y51 (≠ P77), Y61 (≠ E87), H200 (= H226), K226 (= K253), R357 (= R385)
- binding pyridoxal-5'-phosphate: Y51 (≠ P77), S93 (= S119), G94 (= G120), A95 (= A121), H122 (= H148), S172 (= S198), D197 (= D223), A199 (= A225), H200 (= H226), T223 (≠ S250), K226 (= K253), G257 (vs. gap)
2vmxA Crystal structure of f351gbsshmt in complex with l-allo-thr (see paper)
31% identity, 87% coverage: 42:420/435 of query aligns to 16:395/405 of 2vmxA
- active site: Y51 (≠ P77), E53 (≠ L79), D197 (= D223), T223 (≠ S250), K226 (= K253), R232 (≠ A259)
- binding allo-threonine: S31 (≠ A57), H122 (= H148), H200 (= H226), R357 (= R385)
- binding pyridoxal-5'-phosphate: S93 (= S119), G94 (= G120), A95 (= A121), H122 (= H148), S172 (= S198), D197 (= D223), A199 (= A225), H200 (= H226), T223 (≠ S250), K226 (= K253)
Query Sequence
>WP_010439643.1 NCBI__GCF_000192475.1:WP_010439643.1
MTLAQRDWVPTASEALVQDIAKKAASASSDDLMARIENLAEENRRIHEHECFNLNPATNV
MNPKAEALLSSGIGSRPSLGYPGDKYEMGMEAIEQIEVIAAELCAEVFDARFAEVRVPSG
AIANLYGFMATCKAGDTIIAPPGSIGGHVTHHAAGCAGLFGLRTIEAPVNADGYTVDVDQ
LRALAKTERPRLITIGGSLNLFEHPVAEVRAIADEIGAKVMFDAAHQCGIIAGRAWSNPL
KEGAHFMTMSTYKSLGGPAGGLIVTDDEEIAKALDAIAFPGMTANFDAAKTAALAVTMLD
WKAFGSAYANEMIAMAKALSNALDTKGVPVFSGTRGFTNSHQFAVLAAPYGGGQAASKQL
RKCGFLACGIGLPVELVEGDMNGLRIGTPELVRWGMTSGDAERLANLIMRGLGGEQIQSE
VSAWRREFDTLHYVN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory