Comparing WP_010527280.1 NCBI__GCF_000220155.1:WP_010527280.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9S5G5 Histidine biosynthesis bifunctional protein HisB; EC 3.1.3.15; EC 4.2.1.19 from Escherichia coli O157:H7 (see paper)
47% identity, 99% coverage: 5:378/378 of query aligns to 3:355/355 of Q9S5G5
Sites not aligning to the query:
O23346 Imidazoleglycerol-phosphate dehydratase 2, chloroplastic; IGPD 2; Protein HISTIDINE BIOSYNTHESIS 5B; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
46% identity, 49% coverage: 192:378/378 of query aligns to 80:269/272 of O23346
Sites not aligning to the query:
P34047 Imidazoleglycerol-phosphate dehydratase 1, chloroplastic; IGPD 1; Protein HISTIDINE BIOSYNTHESIS 5A; EC 4.2.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
46% identity, 49% coverage: 192:378/378 of query aligns to 78:267/270 of P34047
5el9A A. Thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution (see paper)
46% identity, 49% coverage: 192:378/378 of query aligns to 7:196/199 of 5el9A
6fwhA Acanthamoeba igpd in complex with r-c348 to 1.7a resolution (see paper)
46% identity, 51% coverage: 186:378/378 of query aligns to 1:195/196 of 6fwhA
6fwhL Acanthamoeba igpd in complex with r-c348 to 1.7a resolution (see paper)
46% identity, 51% coverage: 187:378/378 of query aligns to 1:194/195 of 6fwhL
5ekwA A. Thaliana igpd2 in complex with the racemate of the triazole- phosphonate inhibitor, c348 (see paper)
46% identity, 49% coverage: 192:376/378 of query aligns to 7:194/194 of 5ekwA
4qnkA The structure of wt a. Thaliana igpd2 in complex with mn2+ and phosphate (see paper)
47% identity, 46% coverage: 192:366/378 of query aligns to 7:183/185 of 4qnkA
4mu1A The structure of wt a. Thaliana igpd2 in complex with mn2+, imidazole, and sulfate at 1.5 a resolution (see paper)
47% identity, 46% coverage: 192:366/378 of query aligns to 7:183/185 of 4mu1A
4mu0A The structure of wt a. Thaliana igpd2 in complex with mn2+ and 1,2,4- triazole at 1.3 a resolution (see paper)
47% identity, 46% coverage: 192:366/378 of query aligns to 7:183/185 of 4mu0A
2f1dA X-ray structure of imidazoleglycerol-phosphate dehydratase (see paper)
46% identity, 46% coverage: 192:366/378 of query aligns to 6:182/183 of 2f1dA
4mu3A The form a structure of an e21q catalytic mutant of a. Thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution (see paper)
46% identity, 46% coverage: 192:366/378 of query aligns to 7:183/186 of 4mu3A
8qavA Medicago truncatula hisn5 (igpd) in complex with mn and ig2 (see paper)
47% identity, 46% coverage: 192:365/378 of query aligns to 6:181/184 of 8qavA
8qawA Medicago truncatula hisn5 (igpd) in complex with mn, imd, edo, fmt, gol and trs (see paper)
47% identity, 46% coverage: 192:365/378 of query aligns to 7:182/185 of 8qawA
6ezmU Imidazoleglycerol-phosphate dehydratase from saccharomyces cerevisiae (see paper)
39% identity, 51% coverage: 187:378/378 of query aligns to 1:212/212 of 6ezmU
P06633 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
39% identity, 51% coverage: 187:378/378 of query aligns to 3:219/220 of P06633
P9WML9 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 48% coverage: 198:378/378 of query aligns to 21:210/210 of P9WML9
1rhyB Crystal structure of imidazole glycerol phosphate dehydratase (see paper)
45% identity, 47% coverage: 186:364/378 of query aligns to 1:179/180 of 1rhyB
P40374 Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
38% identity, 51% coverage: 188:378/378 of query aligns to 2:216/216 of P40374
7fcyA Crystal structure of m.Tuberculosis imidazole glycerol phosphate dehydratase in complex with an inhibitor
43% identity, 45% coverage: 198:366/378 of query aligns to 12:189/190 of 7fcyA
>WP_010527280.1 NCBI__GCF_000220155.1:WP_010527280.1
MEKPKRILFIDRDGTIIKEPPIDYQVDSLEKLEFYPGVMVNLARIVRHLDFQLVMVTNQD
GLGTPSFPEETFWPAHNKMLETLKGEGIQFSAIHIDRSFPEDNAPTRKPRTGMLKDYLSG
NYDLDNSFVIGDRLTDVELAKNMGCKAILMKKPEEAIPLLEEQNLKNYCVLCSTRWEEIA
DYLFTKERQVTVERNTSETKIKVTLNLDGTGSCDISTGLGFFDHMLEQIGRHSGCDLQIK
VTGDLHVDEHHTIEDTALALGEALKKALGDKRGIERYGFSLPMDDCMAHVAIDFGGRPWL
VWKAKFKREKVGDLPTEMFYHFFKSLADAAAANIYIKAKGKNEHHKIEAIFKALARAIKA
AIRKDPLNRQLPSTKGFL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory