SitesBLAST
Comparing WP_010532213.1 NCBI__GCF_000224785.1:WP_010532213.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
53% identity, 96% coverage: 13:319/320 of query aligns to 8:309/316 of Q81M99
- STRT 57:60 (= STRT 66:69) binding carbamoyl phosphate
- Q84 (= Q93) binding carbamoyl phosphate
- R108 (= R117) binding carbamoyl phosphate
- HPCQ 135:138 (= HPCQ 144:147) binding carbamoyl phosphate
- N166 (= N175) binding L-ornithine
- D230 (= D239) binding L-ornithine
- SM 234:235 (= SM 243:244) binding L-ornithine
- CL 269:270 (= CL 279:280) binding carbamoyl phosphate
- R297 (= R307) binding carbamoyl phosphate
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
54% identity, 96% coverage: 14:319/320 of query aligns to 5:310/315 of Q51742
- W22 (≠ G31) mutation to A: Decreased heat stability.
- E26 (= E35) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ E39) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ K43) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (= Y237) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ Q250) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E287) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
53% identity, 96% coverage: 13:319/320 of query aligns to 4:305/307 of 4nf2A
- active site: R55 (= R68), T56 (= T69), R83 (= R96), R104 (= R117), H131 (= H144), Q134 (= Q147), D226 (= D239), C265 (= C279), R293 (= R307)
- binding phosphoric acid mono(formamide)ester: S53 (= S66), T54 (= T67), R55 (= R68), T56 (= T69), R104 (= R117), H131 (= H144), Q134 (= Q147), C265 (= C279), L266 (= L280), R293 (= R307)
- binding norvaline: L126 (= L139), N162 (= N175), D226 (= D239), S230 (= S243), M231 (= M244)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
52% identity, 95% coverage: 17:319/320 of query aligns to 3:304/307 of P9WIT9
- STRT 50:53 (= STRT 66:69) binding carbamoyl phosphate
- Q77 (= Q93) binding carbamoyl phosphate
- R101 (= R117) binding carbamoyl phosphate
- HPCQ 128:131 (= HPCQ 144:147) binding carbamoyl phosphate
- N160 (= N175) binding L-ornithine
- D224 (= D239) binding L-ornithine
- SM 228:229 (= SM 243:244) binding L-ornithine
- CL 264:265 (= CL 279:280) binding carbamoyl phosphate
- R292 (= R307) binding carbamoyl phosphate
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
52% identity, 95% coverage: 17:319/320 of query aligns to 3:304/307 of 2i6uA
- active site: R52 (= R68), T53 (= T69), R80 (= R96), R101 (= R117), H128 (= H144), Q131 (= Q147), D224 (= D239), C264 (= C279), R292 (= R307)
- binding phosphoric acid mono(formamide)ester: S50 (= S66), T51 (= T67), R52 (= R68), T53 (= T69), R101 (= R117), C264 (= C279), L265 (= L280), R292 (= R307)
- binding norvaline: L123 (= L139), N160 (= N175), D224 (= D239), S228 (= S243), M229 (= M244)
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
52% identity, 95% coverage: 17:319/320 of query aligns to 4:305/308 of 7nouA
- active site: R102 (= R117), H129 (= H144), Q132 (= Q147), D225 (= D239), C265 (= C279), R293 (= R307)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (≠ L61), T52 (= T67), R53 (= R68), R53 (= R68), F56 (≠ V71), F56 (≠ V71), L79 (= L94), D82 (≠ G97), E83 (= E98), V91 (= V106), Y95 (= Y110), L266 (= L280), R293 (= R307)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
52% identity, 95% coverage: 17:319/320 of query aligns to 4:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
52% identity, 95% coverage: 17:319/320 of query aligns to 4:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
52% identity, 95% coverage: 17:319/320 of query aligns to 4:305/308 of 7nnyA
- active site: R102 (= R117), H129 (= H144), Q132 (= Q147), D225 (= D239), C265 (= C279), R293 (= R307)
- binding 1-naphthol: T52 (= T67), R53 (= R68), F56 (≠ V71), E83 (= E98), V91 (= V106), Y95 (= Y110)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
52% identity, 95% coverage: 17:319/320 of query aligns to 4:305/308 of 7nnwA
- active site: R102 (= R117), H129 (= H144), Q132 (= Q147), D225 (= D239), C265 (= C279), R293 (= R307)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (≠ L61), T52 (= T67), R53 (= R68), F56 (≠ V71), L79 (= L94), L92 (= L107), Y95 (= Y110)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
52% identity, 95% coverage: 17:319/320 of query aligns to 4:305/308 of 7nnvA
- active site: R102 (= R117), H129 (= H144), Q132 (= Q147), D225 (= D239), C265 (= C279), R293 (= R307)
- binding phosphoric acid mono(formamide)ester: S51 (= S66), T52 (= T67), R53 (= R68), T54 (= T69), R102 (= R117), H129 (= H144), C265 (= C279), L266 (= L280), R293 (= R307)
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
51% identity, 95% coverage: 17:319/320 of query aligns to 4:302/305 of 7np0A
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
51% identity, 95% coverage: 17:319/320 of query aligns to 4:299/302 of 7novA
- active site: R96 (= R117), H123 (= H144), Q126 (= Q147), D219 (= D239), C259 (= C279), R287 (= R307)
- binding (4-methyl-3-nitro-phenyl)-oxidanyl-oxidanylidene-boron: R53 (= R68), F56 (≠ V71), E77 (= E98), V85 (= V106), Y89 (= Y110), L260 (= L280), A284 (= A304), R287 (= R307)
7nnzB Crystal structure of mycobacterium tuberculosis argf in complex with 5-methyl-4-phenylthiazol-2-amine.
50% identity, 95% coverage: 17:319/320 of query aligns to 3:294/297 of 7nnzB
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
46% identity, 95% coverage: 17:319/320 of query aligns to 2:302/304 of 8qeuA
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
43% identity, 98% coverage: 6:320/320 of query aligns to 29:343/354 of P00481
- R92 (= R68) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (= C279) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
42% identity, 98% coverage: 6:320/320 of query aligns to 29:343/354 of P00480
- G39 (= G16) to C: in OTCD; late onset; dbSNP:rs72554306
- R40 (= R17) to H: in OTCD; late onset; dbSNP:rs72554308
- L43 (= L20) to F: in dbSNP:rs72554309
- K46 (≠ T23) to R: in dbSNP:rs1800321
- Y55 (= Y32) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (= L40) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (= K64) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 66:69) binding carbamoyl phosphate
- G100 (= G76) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ I77) to L: in dbSNP:rs1133135
- L111 (= L87) to P: in dbSNP:rs1800324
- T125 (≠ A101) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D102) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (≠ K105) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (≠ I116) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R117) binding carbamoyl phosphate; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H144) binding carbamoyl phosphate
- Q171 (= Q147) binding carbamoyl phosphate
- I172 (≠ V148) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ L152) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TI 154:155) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ K159) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (= G164) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (= G171) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (= D172) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ A177) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (≠ G183) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (= A185) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (= M189) to K: in OTCD; late onset
- H214 (≠ D190) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P196) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (= P201) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ V220) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (= T238) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (≠ V240) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W241) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G245) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (= Q246) to R: in dbSNP:rs1800328
- E272 (≠ D248) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (= R253) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H278) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (= C279) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (= CL 279:280) binding carbamoyl phosphate
- E309 (= E286) natural variant: Missing (in OTCD; late onset)
- R330 (= R307) binding carbamoyl phosphate
- T333 (≠ A310) natural variant: T -> A
- S340 (≠ A317) to P: in OTCD; late onset; dbSNP:rs72558489
- T343 (≠ S320) to K: in OTCD; late onset; dbSNP:rs72558491
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
42% identity, 96% coverage: 13:320/320 of query aligns to 3:310/321 of 1othA
- active site: R59 (= R68), T60 (= T69), V87 (≠ R96), R108 (= R117), H135 (= H144), Q138 (= Q147), D230 (= D239), C270 (= C279), R297 (= R307)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S66), T58 (= T67), R59 (= R68), T60 (= T69), R108 (= R117), L130 (= L139), H135 (= H144), N166 (= N175), D230 (= D239), S234 (= S243), M235 (= M244), C270 (= C279), L271 (= L280), R297 (= R307)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
42% identity, 96% coverage: 13:320/320 of query aligns to 3:310/321 of 1c9yA
- active site: R59 (= R68), T60 (= T69), V87 (≠ R96), R108 (= R117), H135 (= H144), Q138 (= Q147), D230 (= D239), C270 (= C279), R297 (= R307)
- binding phosphoric acid mono(formamide)ester: S57 (= S66), T58 (= T67), R59 (= R68), T60 (= T69), R108 (= R117), C270 (= C279), L271 (= L280), R297 (= R307)
- binding norvaline: L130 (= L139), N166 (= N175), D230 (= D239), S234 (= S243), M235 (= M244)
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
44% identity, 95% coverage: 17:319/320 of query aligns to 2:295/297 of 8qevA
Query Sequence
>WP_010532213.1 NCBI__GCF_000224785.1:WP_010532213.1
MKTKAEPVFTGNELKGRKFLKLTDLNIQELGYLLELAGELKQKHKSGLHEEPLKAKTLGM
LFEKPSTRTRVSFETGIFQLGGSGIFLNSDNLQLGRGESMADTAKVLSGYVDGMMIRTFS
HEVLEEFAQNATVPVINGLTDMYHPCQVLADLQTIREIKNGLSGVKLAYIGDGNNMAHSL
MIGAAMTGMDINIAAPDDYMPNTSIVQEALTIAEQTGGHVEVTSDPQAAAEQADVIYTDV
WASMGQEDEQGNRKQAFSDFQVNVRLCSLAKNDAFFMHCLPAHRGEEVTADVIDGKQSVV
FQQAENRLHAQKALMMALMS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory