Comparing WP_010876057.1 NCBI__GCF_000008645.1:WP_010876057.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2zktB Structure of ph0037 protein from pyrococcus horikoshii
35% identity, 99% coverage: 1:399/402 of query aligns to 1:375/381 of 2zktB
2zktA Structure of ph0037 protein from pyrococcus horikoshii
36% identity, 45% coverage: 218:399/402 of query aligns to 143:324/330 of 2zktA
Sites not aligning to the query:
7tl8A 1.95a resolution structure of independent phosphoglycerate mutase from s. Aureus in complex with a macrocyclic peptide inhibitor (sa-d3) (see paper)
33% identity, 19% coverage: 287:363/402 of query aligns to 370:453/488 of 7tl8A
Sites not aligning to the query:
4nwxA Crystal structure of phosphoglycerate mutase from staphylococcus aureus in 2-phosphoglyceric acid bound form (see paper)
33% identity, 19% coverage: 287:363/402 of query aligns to 385:468/503 of 4nwxA
Sites not aligning to the query:
4nwjA Crystal structure of phosphopglycerate mutase from staphylococcus aureus in 3-phosphoglyceric acid bound form. (see paper)
33% identity, 19% coverage: 287:363/402 of query aligns to 386:469/504 of 4nwjA
Sites not aligning to the query:
1o98A 1.4a crystal structure of phosphoglycerate mutase from bacillus stearothermophilus complexed with 2-phosphoglycerate (see paper)
30% identity, 20% coverage: 284:363/402 of query aligns to 389:475/509 of 1o98A
Sites not aligning to the query:
Q9X519 2,3-bisphosphoglycerate-independent phosphoglycerate mutase; 23PGA-independent; BPG-independent PGAM; Phosphoglyceromutase; iPGM; EC 5.4.2.12 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 4 papers)
30% identity, 20% coverage: 284:363/402 of query aligns to 390:476/511 of Q9X519
Sites not aligning to the query:
1ejjA Crystal structural analysis of phosphoglycerate mutase cocrystallized with 3-phosphoglycerate (see paper)
30% identity, 20% coverage: 284:363/402 of query aligns to 388:474/508 of 1ejjA
Sites not aligning to the query:
>WP_010876057.1 NCBI__GCF_000008645.1:WP_010876057.1
MITMKHVILVGDGMADYPLDELDGKTPLQVADKPNMDQLAGMGACGLLRTVPEGMEAGSD
VANLSIMGYDPRRYYTGRGPLEAASIGVELGDDDVAFRCNLINADERIVDFNAGHIETAE
ASSLIDALNHELETRGRFYAGVSYRNLFVIEGRGYTSVRVEPPHDIVGESVAAHLPSGSE
EADHIRELMLESAGVLRSHEVNLKRESMGKRPATMIWLWGQGLRPSMEPFSERYGIRGAT
ITAVDLIKGLGVYAGLENIHVPGATGYLDTDYRAKGRYAAGALEEYDFLYVHVEAPDEAG
HAGDAEEKIRAIENIDRFVLGRLLDALSDHEHRIAVLPDHPTPIEIRTHVPDPVPCILAG
DGVDADQVKSYDEFTVREGSLGTWEAHRLMEIMMDPAARLRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory