Comparing WP_010876434.1 NCBI__GCF_000008645.1:WP_010876434.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q57658 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
58% identity, 98% coverage: 2:341/347 of query aligns to 9:347/354 of Q57658
1ys4A Structure of aspartate-semialdehyde dehydrogenase from methanococcus jannaschii (see paper)
58% identity, 98% coverage: 2:341/347 of query aligns to 3:341/348 of 1ys4A
P78780 Probable aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
48% identity, 98% coverage: 4:342/347 of query aligns to 6:350/357 of P78780
3hskA Crystal structure of aspartate semialdehyde dehydrogenase with NADP from candida albicans (see paper)
45% identity, 98% coverage: 5:344/347 of query aligns to 6:353/358 of 3hskA
4zicC Crystal structure of aspartate semialdehyde dehydrogenase with NADP from trichophyton rubrum (see paper)
44% identity, 97% coverage: 4:341/347 of query aligns to 4:349/357 of 4zicC
6c8wA Crystal structure of aspartate semialdehyde dehydrogenase with NADP from blastomyces dermatitidis (see paper)
44% identity, 97% coverage: 4:341/347 of query aligns to 5:349/357 of 6c8wA
6c85A Crystal structure of aspartate semialdehyde dehydrogenase from blastomyces dermatitidis with p-benzoquinone (see paper)
45% identity, 97% coverage: 4:341/347 of query aligns to 5:346/354 of 6c85A
4dpmA Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with coa (see paper)
42% identity, 99% coverage: 2:345/347 of query aligns to 3:348/354 of 4dpmA
4dplA Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with NADP (see paper)
42% identity, 99% coverage: 2:345/347 of query aligns to 3:348/354 of 4dplA
4dpkA Structure of malonyl-coenzyme a reductase from crenarchaeota (see paper)
42% identity, 99% coverage: 2:345/347 of query aligns to 3:348/354 of 4dpkA
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
30% identity, 99% coverage: 2:346/347 of query aligns to 5:343/346 of Q04797
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
34% identity, 98% coverage: 3:343/347 of query aligns to 5:331/336 of 2r00C
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
34% identity, 98% coverage: 3:343/347 of query aligns to 6:332/337 of P23247
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
29% identity, 99% coverage: 3:345/347 of query aligns to 3:342/361 of 3pylC
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
29% identity, 99% coverage: 3:345/347 of query aligns to 3:342/360 of 4r51A
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
29% identity, 99% coverage: 3:345/347 of query aligns to 3:342/357 of 4r54A
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
29% identity, 99% coverage: 3:345/347 of query aligns to 3:342/357 of 4r41A
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
29% identity, 99% coverage: 3:345/347 of query aligns to 3:342/357 of 4r3nA
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
29% identity, 99% coverage: 3:345/347 of query aligns to 3:342/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
29% identity, 99% coverage: 3:345/347 of query aligns to 3:342/357 of 3pwsA
>WP_010876434.1 NCBI__GCF_000008645.1:WP_010876434.1
MVNVGVLGATGMVGQRFIQMLDKHPEFELTTLAASSRSAGKPYGEVANWYLDCEMPESVR
DMEVVETDPSAVGDVDILFSALPADVARKVEPKFAEKYIVASNASAMRMEPDVPLVIPEV
NPEFLDLIEVQQRRRGWDGFIVTNPNCSTIALTLTLKPIYDAYTIKRVYVSTMQAVSGAG
YNGVPSMAILDNLVPFIGGEEEKIETETLHLLGELDEGVVKPASFGVSASCHRVPVVDGH
TEAVFIELDDEFDIDDVREAMDKFRGLPQKLGLHSAPEKPVVVRDEENRPQPRMDRDMDG
GMAVTVGRLREDAAFKNSLRYVLVGHNTVRGAAGASILNAELINEIL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory