Comparing WP_010876462.1 NCBI__GCF_000008645.1:WP_010876462.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
55% identity, 92% coverage: 4:159/170 of query aligns to 2:157/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
55% identity, 92% coverage: 4:159/170 of query aligns to 2:157/167 of 2pkpA
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 87% coverage: 15:162/170 of query aligns to 554:721/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 58% coverage: 15:113/170 of query aligns to 18:119/198 of P9WK95
Sites not aligning to the query:
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
32% identity, 55% coverage: 14:107/170 of query aligns to 611:710/780 of P20004
Sites not aligning to the query:
P09339 Aconitate hydratase A; ACN; Aconitase; Aconitate/2-methylaconitate hydratase; Iron-responsive protein-like; IRP-like; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.- from Bacillus subtilis (strain 168) (see 2 papers)
39% identity, 31% coverage: 52:104/170 of query aligns to 777:830/909 of P09339
Sites not aligning to the query:
>WP_010876462.1 NCBI__GCF_000008645.1:WP_010876462.1
MEGIIRGRVWRFGDNVDTDMIIPGRYLRTFSLDELASHVMEGARPEFASQVRKGDIIVAG
RNFGCGSSREQAPVALKHAGVVAIIAESFARIFYRNAINIGLPVIMAKVDADDGDEVSID
LRSGQIRNLTAGSEYRMKPFNDYMLSILEDGGLVNHYLKTIDTGISGDEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory