SitesBLAST
Comparing WP_010876559.1 NCBI__GCF_000008645.1:WP_010876559.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
45% identity, 98% coverage: 5:331/332 of query aligns to 14:348/348 of 5t61L
- binding iron/sulfur cluster: C30 (= C21), A31 (≠ T22), V32 (≠ G23), C33 (= C24), G34 (= G25), C36 (= C27), C40 (= C31), P41 (= P32), C70 (= C61), V71 (= V62), L72 (= L63), C73 (= C64), G74 (= G65), C76 (= C67), C80 (= C71), L85 (≠ I76), C114 (= C105), C117 (= C108), K118 (≠ G109), C120 (= C111), C124 (= C115), I129 (≠ L120), I146 (= I137), C153 (= C144), C156 (= C147), C159 (= C150), C163 (= C154), P164 (= P155), I168 (= I159), I186 (= I177), C193 (= C184), H195 (≠ Y186), C196 (= C187), G197 (= G188), C199 (= C190), C203 (= C194), P204 (= P195), I208 (= I199), C212 (= C203), C215 (= C206), C238 (= C227), V239 (≠ A228), N240 (≠ H229), C241 (= C230), G242 (= G231), C244 (= C233), C248 (= C237), P249 (= P238), C270 (= C259), A272 (≠ S263), C273 (= C264), E274 (≠ H265), C276 (= C267), C280 (= C271), P281 (= P272), V284 (≠ A275), C307 (= C290), I308 (≠ V291), Y309 (≠ F292), C310 (= C293), G311 (= G294), C313 (= C296), C317 (= C300)
7bkbK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
33% identity, 98% coverage: 1:325/332 of query aligns to 16:358/386 of 7bkbK
- binding iron/sulfur cluster: C36 (= C21), T37 (= T22), C39 (= C24), C42 (= C27), C46 (= C31), P47 (= P32), I51 (= I36), C77 (= C61), S78 (≠ V62), Y79 (≠ L63), C80 (= C64), G81 (= G65), C83 (= C67), C87 (= C71), L92 (≠ I76), I119 (= I100), C124 (= C105), V125 (≠ F106), C127 (= C108), C130 (= C111), C134 (= C115), I139 (≠ L120), C173 (= C144), T174 (≠ I145), K175 (≠ Y146), C176 (= C147), C179 (= C150), C183 (= C154), I186 (≠ S157), C211 (= C184), D212 (≠ L185), C214 (= C187), N215 (≠ G188), C217 (= C190), C221 (= C194), P222 (= P195), V241 (= V220), C248 (= C227), C249 (≠ A228), C251 (= C230), C254 (= C233), C258 (= C237), P259 (= P238), I263 (= I242), V265 (= V244), I273 (= I252), C280 (= C259), P281 (≠ R260), C284 (= C264), T286 (≠ A266), C287 (= C267), C291 (= C271), C322 (= C290), I323 (≠ V291), L324 (≠ F292), C325 (= C293), G326 (= G294), C328 (= C296), C332 (= C300), P333 (= P301)
7bkcK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (dimeric, composite structure) (see paper)
31% identity, 69% coverage: 98:325/332 of query aligns to 29:293/321 of 7bkcK
- binding iron/sulfur cluster: C36 (= C105), T37 (≠ F106), C39 (= C108), C42 (= C111), C46 (= C115), P47 (= P116), I51 (≠ L120), C77 (= C144), S78 (≠ I145), Y79 (= Y146), C80 (= C147), G81 (= G148), C83 (= C150), C87 (= C154), L92 (≠ I159), I119 (≠ V179), C124 (= C184), V125 (≠ L185), C127 (= C187), C130 (= C190), C134 (= C194), P135 (= P195), I139 (= I199), I178 (≠ T222), C183 (= C227), C184 (≠ A228), T185 (≠ H229), C186 (= C230), R187 (≠ G231), C189 (= C233), C193 (= C237), P194 (= P238), I198 (= I242), I208 (= I252), C215 (= C259), P216 (≠ R260), C219 (= C264), T221 (≠ A266), C222 (= C267), C226 (= C271), C257 (= C290), I258 (≠ V291), L259 (≠ F292), C260 (= C293), G261 (= G294), C263 (= C296), C267 (= C300), P268 (= P301)
8oh5C Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
36% identity, 28% coverage: 57:148/332 of query aligns to 609:696/1172 of 8oh5C
- binding iron/sulfur cluster: C613 (= C61), V614 (= V62), L615 (= L63), C616 (= C64), G617 (= G65), C619 (= C67), C623 (= C71), I643 (≠ P92), C656 (= C105), I657 (≠ F106), S658 (≠ L107), C659 (= C108), G660 (= G109), C662 (= C111), C666 (= C115), G669 (≠ N118), A670 (= A119), C692 (= C144), Y694 (= Y146), C695 (= C147)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 199, 201, 202, 203, 222, 223, 229, 230, 235, 239, 264, 265, 285, 288, 332, 471, 477, 479
- binding fe2/s2 (inorganic) cluster: 36, 45, 47, 48, 50, 64
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 330, 331, 332, 333, 353, 354, 355, 432, 433, 434, 477
- binding iron/sulfur cluster: 96, 98, 100, 102, 104, 108, 147, 149, 151, 155, 156, 164, 170, 480, 562, 563, 565, 567, 573, 699, 725, 727, 728, 853
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
48% identity, 18% coverage: 17:77/332 of query aligns to 563:613/613 of 7p8nB
- binding iron/sulfur cluster: C567 (= C21), C570 (= C24), G571 (= G25), C573 (= C27), C577 (= C31), Y590 (≠ V54), I592 (≠ F56), C597 (= C61), K599 (≠ L63), C600 (= C64), G601 (= G65), C603 (= C67), C607 (= C71)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 34, 36, 67, 68, 69, 70, 71
- binding flavin mononucleotide: 185, 186, 187, 213, 215, 216, 217, 301, 304, 305, 306, 340, 341, 521, 522
- binding iron/sulfur cluster: 320, 473, 474, 475, 476, 477, 480, 519, 520, 522, 523, 560
- binding zinc ion: 457, 544, 549, 554
7plmA Cryoem reconstruction of pyruvate ferredoxin oxidoreductase (pfor) in anaerobic conditions (see paper)
27% identity, 40% coverage: 32:165/332 of query aligns to 630:764/1177 of 7plmA
- binding iron/sulfur cluster: P657 (vs. gap), W659 (vs. gap), C664 (= C61), I665 (≠ V62), Q666 (≠ L63), C667 (= C64), N668 (≠ G65), C670 (= C67), C674 (= C71), P675 (≠ I72), I679 (= I76), I708 (≠ L98), C715 (= C105), M716 (≠ F106), G717 (≠ L107), C718 (= C108), G719 (= G109), C721 (= C111), C725 (= C115), P726 (= P116), A731 (≠ S131), L732 (= L132)
Sites not aligning to the query:
- binding calcium ion: 950, 952, 1026, 1028
- binding magnesium ion: 930, 958, 960, 962
- binding iron/sulfur cluster: 458, 781, 782, 785, 787, 810, 962, 1038, 1039
- binding thiamine diphosphate: 27, 28, 29, 63, 787, 808, 809, 810, 839, 929, 930, 931, 960, 961, 962, 963, 964
2c3uA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form (see paper)
26% identity, 40% coverage: 32:165/332 of query aligns to 654:793/1231 of 2c3uA
- binding iron/sulfur cluster: P681 (vs. gap), W683 (vs. gap), C688 (= C61), I689 (≠ V62), C691 (= C64), N692 (≠ G65), C694 (= C67), C698 (= C71), P699 (≠ I72), A702 (= A75), I703 (= I76), C744 (= C105), M745 (≠ F106), G746 (≠ L107), C747 (= C108), G748 (= G109), C750 (= C111), C754 (= C115), P755 (= P116), A760 (≠ S131), L761 (= L132)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding 2-(3-{[4-(hydroxyamino)-2-methylpyrimidin-5-yl]methyl}-4-methyl-2,3-dihydro-1,3-thiazol-5-yl)ethyl trihydrogen diphosphate: 28, 29, 63, 87, 816, 837, 839, 868, 869, 961, 962, 963, 964, 992, 993, 994, 995, 996
- binding calcium ion: 982, 984, 1055, 1056, 1058, 1060, 1062
- binding magnesium ion: 962, 990, 992
- binding pyruvic acid: 30, 113, 122, 995
- binding iron/sulfur cluster: 458, 811, 814, 816, 839, 1070, 1071
2c3pA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
26% identity, 40% coverage: 32:165/332 of query aligns to 654:793/1231 of 2c3pA
- binding iron/sulfur cluster: P681 (vs. gap), W683 (vs. gap), C688 (= C61), I689 (≠ V62), Q690 (≠ L63), C691 (= C64), N692 (≠ G65), C694 (= C67), C698 (= C71), P699 (≠ I72), A702 (= A75), I703 (= I76), C744 (= C105), M745 (≠ F106), G746 (≠ L107), C747 (= C108), G748 (= G109), C750 (= C111), C754 (= C115), P755 (= P116), A760 (≠ S131), L761 (= L132)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding 1-(2-{(2s,4r,5r)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1s)-1-carboxy-1-hydroxyethyl]-4-methyl-1,3-thiazolidin-5-yl}ethoxy)-1,1,3,3-tetrahydroxy-1lambda~5~-diphosphox-1-en-2-ium 3-oxide: 28, 29, 30, 63, 87, 113, 816, 837, 838, 839, 868, 869, 961, 962, 963, 992, 993, 994, 995, 996
- binding calcium ion: 982, 983, 984, 1055, 1056, 1058, 1060, 1062
- binding magnesium ion: 962, 990, 992
- binding iron/sulfur cluster: 458, 810, 811, 814, 816, 839, 994, 1070, 1071
2c3oA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
26% identity, 40% coverage: 32:165/332 of query aligns to 654:793/1231 of 2c3oA
- binding iron/sulfur cluster: P681 (vs. gap), C688 (= C61), I689 (≠ V62), C691 (= C64), N692 (≠ G65), C694 (= C67), C698 (= C71), P699 (≠ I72), A702 (= A75), I703 (= I76), C744 (= C105), G746 (≠ L107), C747 (= C108), G748 (= G109), N749 (= N110), C750 (= C111), C754 (= C115), A760 (≠ S131), L761 (= L132)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding calcium ion: 982, 984, 1056, 1058, 1060
- binding magnesium ion: 962, 990, 992
- binding pyruvic acid: 30, 113, 996
- binding iron/sulfur cluster: 458, 810, 811, 814, 816, 839, 1070, 1071
- binding thiamine diphosphate: 28, 29, 63, 87, 816, 837, 838, 839, 868, 961, 962, 963, 992, 993, 994, 995, 996
1kekA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase (see paper)
26% identity, 40% coverage: 32:165/332 of query aligns to 654:793/1231 of 1kekA
- binding iron/sulfur cluster: P681 (vs. gap), W683 (vs. gap), C688 (= C61), I689 (≠ V62), Q690 (≠ L63), C691 (= C64), N692 (≠ G65), C694 (= C67), C698 (= C71), P699 (≠ I72), I703 (= I76), I737 (≠ L98), C744 (= C105), M745 (≠ F106), G746 (≠ L107), C747 (= C108), G748 (= G109), C750 (= C111), C754 (= C115), P755 (= P116), A760 (≠ S131), L761 (= L132)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding calcium ion: 982, 984, 1055, 1056, 1058, 1062
- binding 2-acetyl-thiamine diphosphate: 29, 63, 87, 113, 816, 837, 838, 839, 868, 961, 962, 963, 992, 993, 994, 995, 996
- binding magnesium ion: 962, 990, 992
- binding iron/sulfur cluster: 458, 810, 811, 814, 816, 839, 1070, 1071
1b0pA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
26% identity, 40% coverage: 32:165/332 of query aligns to 654:793/1231 of 1b0pA
- binding iron/sulfur cluster: P681 (vs. gap), W683 (vs. gap), C688 (= C61), I689 (≠ V62), Q690 (≠ L63), C691 (= C64), N692 (≠ G65), C694 (= C67), C698 (= C71), P699 (≠ I72), A702 (= A75), I703 (= I76), I737 (≠ L98), C744 (= C105), M745 (≠ F106), C747 (= C108), G748 (= G109), C750 (= C111), C754 (= C115), P755 (= P116), A760 (≠ S131)
Sites not aligning to the query:
- active site: 30, 63, 113, 995
- binding calcium ion: 982, 984, 1055, 1056, 1058, 1060
- binding magnesium ion: 962, 990, 992
- binding iron/sulfur cluster: 458, 811, 814, 816, 839, 994, 1070, 1071
- binding thiamine diphosphate: 28, 29, 63, 816, 837, 838, 839, 868, 961, 962, 963, 992, 993, 994, 995, 996
P94692 Pyruvate:ferredoxin oxidoreductase; PFOR; POR; Pyruvate synthase; EC 1.2.7.1 from Desulfocurvibacter africanus (Desulfovibrio africanus) (see 3 papers)
26% identity, 40% coverage: 32:165/332 of query aligns to 655:794/1232 of P94692
- C689 (= C61) binding
- C692 (= C64) binding
- C695 (= C67) binding
- C699 (= C71) binding
- C745 (= C105) binding
- C748 (= C108) binding
- C751 (= C111) binding
- C755 (= C115) binding
Sites not aligning to the query:
- 31 binding
- 64 binding
- 114 binding
- 812 binding
- 815 binding
- 817 binding
- 840 binding ; binding
- 962:965 binding
- 963 binding
- 983 binding
- 985 binding
- 991 binding
- 991:996 binding
- 993 binding
- 1056 binding
- 1059 binding
- 1061 binding
- 1063 binding
- 1071 binding
5gupH structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
28% identity, 39% coverage: 19:149/332 of query aligns to 29:159/176 of 5gupH
- binding (9r,11s)-9-({[(1s)-1-hydroxyhexadecyl]oxy}methyl)-2,2-dimethyl-5,7,10-trioxa-2lambda~5~-aza-6lambda~5~-phosphaoctacosane-6,6,11-triol: L30 (= L20)
- binding iron/sulfur cluster: H65 (≠ I49), C77 (= C61), I78 (≠ V62), A79 (≠ L63), C80 (= C64), K81 (≠ G65), C83 (= C67), C87 (= C71), C116 (= C105), I117 (≠ F106), Y118 (≠ L107), C119 (= C108), G120 (= G109), F121 (≠ N110), C122 (= C111), C126 (= C115), P127 (= P116), A130 (= A119), I131 (≠ L120)
- binding : R108 (≠ F93), N150 (≠ S140)
Sites not aligning to the query:
8iufS8 ndufv2 (see paper)
47% identity, 17% coverage: 142:199/332 of query aligns to 73:129/182 of 8iufS8
- binding iron/sulfur cluster: C75 (= C144), I76 (= I145), T77 (≠ Y146), C78 (= C147), Q79 (≠ G148), C81 (= C150), C85 (= C154), P86 (= P155), I90 (= I159), C114 (= C184), I115 (≠ L185), Y116 (= Y186), C117 (= C187), G118 (= G188), C120 (= C190), C124 (= C194), I129 (= I199)
Sites not aligning to the query:
7p63I Complex i from e. Coli, ddm/lmng-purified, under turnover at ph 6, closed state (see paper)
37% identity, 26% coverage: 41:126/332 of query aligns to 40:120/180 of 7p63I
- binding iron/sulfur cluster: I48 (= I49), C60 (= C61), V61 (= V62), A62 (≠ L63), C63 (= C64), N64 (≠ G65), C66 (= C67), C70 (= C71), C74 (≠ A75), I75 (= I76), F92 (≠ L98), C99 (= C105), I100 (≠ F106), F101 (≠ L107), C102 (= C108), G103 (= G109), L104 (≠ N110), C105 (= C111), C109 (= C115), P110 (= P116), T111 (≠ R117), I114 (≠ L120)
Q56224 NADH-quinone oxidoreductase subunit 9; NADH dehydrogenase I subunit 9; NDH-1 subunit 9; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
37% identity, 24% coverage: 140:218/332 of query aligns to 49:132/182 of Q56224
- C53 (= C144) binding
- C56 (= C147) binding
- S57 (≠ G148) binding
- C59 (= C150) binding
- C63 (= C154) binding
- C98 (= C184) binding
- I99 (≠ L185) binding
- C101 (= C187) binding
- C104 (= C190) binding
- C108 (= C194) binding
4hea9 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
37% identity, 24% coverage: 140:218/332 of query aligns to 48:131/180 of 4hea9
- binding iron/sulfur cluster: C52 (= C144), G54 (≠ Y146), C55 (= C147), S56 (≠ G148), L57 (≠ E149), C58 (= C150), C62 (= C154), P63 (= P155), I67 (= I159), Y90 (≠ I177), C97 (= C184), I98 (≠ L185), F99 (≠ Y186), C100 (= C187), G101 (= G188), L102 (≠ I189), C103 (= C190), C107 (= C194), P108 (= P195), T109 (≠ V196), A111 (= A198), I112 (= I199)
Sites not aligning to the query:
7ak5I Cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a (see paper)
30% identity, 31% coverage: 19:121/332 of query aligns to 31:134/178 of 7ak5I
- binding iron/sulfur cluster: H67 (≠ I49), C79 (= C61), I80 (≠ V62), A81 (≠ L63), C82 (= C64), K83 (≠ G65), C85 (= C67), C89 (= C71), C118 (= C105), I119 (≠ F106), Y120 (≠ L107), C121 (= C108), G122 (= G109), C124 (= C111), C128 (= C115), I133 (≠ L120)
Sites not aligning to the query:
8b6fAL ndutt15 (see paper)
31% identity, 26% coverage: 36:121/332 of query aligns to 93:173/218 of 8b6fAL
- binding iron/sulfur cluster: H106 (≠ I49), C118 (= C61), I119 (≠ V62), C121 (= C64), K122 (≠ G65), C124 (= C67), C128 (= C71), I133 (= I76), Y150 (≠ L98), C157 (= C105), I158 (≠ F106), Y159 (≠ L107), C160 (= C108), G161 (= G109), C163 (= C111), C167 (= C115), P168 (= P116), A171 (= A119), I172 (≠ L120)
Sites not aligning to the query:
8b9zI Drosophila melanogaster complex i in the active state (dm1) (see paper)
31% identity, 26% coverage: 36:121/332 of query aligns to 62:142/186 of 8b9zI
- binding iron/sulfur cluster: H75 (≠ I49), C87 (= C61), I88 (≠ V62), A89 (≠ L63), C90 (= C64), K91 (≠ G65), C93 (= C67), C97 (= C71), P98 (≠ I72), Y119 (≠ W94), C126 (= C105), I127 (≠ F106), Y128 (≠ L107), C129 (= C108), G130 (= G109), F131 (≠ N110), C132 (= C111), C136 (= C115), A140 (= A119), I141 (≠ L120)
Sites not aligning to the query:
Query Sequence
>WP_010876559.1 NCBI__GCF_000008645.1:WP_010876559.1
MLVNERMGSERRTLNYNPDLCTGCGLCSETCPVNAIDRAPLLPIARGLIKMNRVSFNKEK
CVLCGLCASVCIFGAIDLQKDGKSIRGADEYPFWDFKLEIDDEKCFLCGNCADACPRNAL
LTIRDLPERKSLVKGEINVSMEKCIYCGECAAMCPASAIEISWRDPDSSNMAIADGIRVD
EDKCLYCGICKRICPVGAIRMSCLTCMYNEELKATVEGAVITIDERCAHCGWCMEICPAN
AITVKKPIRGTISQADERCRGESCHACVDVCPCNAISIINGTARIDEKFCVFCGACSSVC
PDGLLSIERSELRIRNLKSVAWEHIIKTALQK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory