Comparing WP_010877422.1 NCBI__GCF_000008645.1:WP_010877422.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
28% identity, 96% coverage: 11:316/319 of query aligns to 14:345/347 of 2vatA
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
27% identity, 96% coverage: 11:316/319 of query aligns to 15:347/350 of 2vavB
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
28% identity, 72% coverage: 66:296/319 of query aligns to 79:321/387 of Q6FEQ3
Sites not aligning to the query:
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
30% identity, 60% coverage: 10:200/319 of query aligns to 9:214/358 of P45131
Sites not aligning to the query:
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
24% identity, 97% coverage: 10:317/319 of query aligns to 13:362/368 of 7rytB
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
24% identity, 97% coverage: 10:317/319 of query aligns to 14:363/366 of 6puxA
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
26% identity, 60% coverage: 12:203/319 of query aligns to 6:209/346 of 5w8oB
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
24% identity, 97% coverage: 10:317/319 of query aligns to 13:362/367 of 8f2lA
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
24% identity, 80% coverage: 46:301/319 of query aligns to 46:346/375 of 6iohA
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
24% identity, 80% coverage: 46:301/319 of query aligns to 46:346/366 of 6ioiA
Sites not aligning to the query:
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
29% identity, 63% coverage: 1:200/319 of query aligns to 1:220/374 of D2Z028
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 55% coverage: 77:252/319 of query aligns to 158:360/504 of Q10341
Sites not aligning to the query:
>WP_010877422.1 NCBI__GCF_000008645.1:WP_010877422.1
MMEEIPASYFKIEEFQFESGEKIQEAPVEYRTTGKPSLDDMGVIDNAVIYIHGWSGDCSS
VRRIAALTEPGGALENFFVISISSLGSPGSASPSTTAMGKDFPEYTILDMVNFQRQFLDE
KFGIRKVRGVIGTSMGGFQALQWAAEYPDEMEFLIPLVTSWQVRGINYALFSYMNHLIEG
DPEFRAGTRPERALSLASMLMYLHGLSREYYQGLENAELESSMMDMGSEGALMDPYDVIW
RNRAAMKHDLSGKLESIRARTLIFGVNQDRYFPPELDTIPMAQLIPKAELVLFDSECGHL
GVNEIGKYNEIIVSFIGGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory