SitesBLAST
Comparing WP_010936234.1 NCBI__GCF_000011905.1:WP_010936234.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
5ygeA Arga complexed with acecoa and glutamate (see paper)
32% identity, 85% coverage: 3:136/158 of query aligns to 6:140/169 of 5ygeA
- binding acetyl coenzyme *a: Y25 (≠ F22), I73 (≠ V69), V76 (≠ L72), A77 (= A73), V78 (= V74), T83 (≠ H79), G84 (≠ R80), H85 (≠ Q81), G86 (= G82), G88 (= G84), H89 (≠ E85), T111 (= T107), E113 (≠ K109), F117 (= F113)
- binding glutamic acid: K33 (≠ R31), E44 (≠ D42), H64 (= H60), R74 (≠ K70)
Sites not aligning to the query:
6addA The crystal structure of rv2747 from mycobacterium tuberculosis in complex with coa and nlq (see paper)
32% identity, 85% coverage: 3:136/158 of query aligns to 5:139/168 of 6addA
- binding coenzyme a: Y24 (≠ F22), I28 (≠ Q27), V75 (≠ L72), A76 (= A73), V77 (= V74), T82 (≠ H79), G83 (≠ R80), H84 (≠ Q81), G85 (= G82), G87 (= G84), H88 (≠ E85), T110 (= T107), E112 (≠ K109), F115 (= F112)
- binding n~2~-acetyl-l-glutamine: K27 (≠ H25), I28 (≠ Q27), L30 (= L29), T74 (≠ S71), L109 (= L106)
Sites not aligning to the query:
5yo2A The crystal structure of rv2747 from mycobacterium tuberculosis in complex with acetyl coa and l-arginine (see paper)
32% identity, 85% coverage: 3:136/158 of query aligns to 5:139/168 of 5yo2A
- binding acetyl coenzyme *a: Y24 (≠ F22), I28 (≠ Q27), I72 (≠ V69), R73 (≠ K70), T74 (≠ S71), V75 (≠ L72), V77 (= V74), T82 (≠ H79), G83 (≠ R80), H84 (≠ Q81), G85 (= G82), G87 (= G84), H88 (≠ E85), T110 (= T107), E112 (≠ K109), F115 (= F112), F116 (= F113)
- binding arginine: G26 (≠ D24), L29 (≠ M28), L30 (= L29), R73 (≠ K70), L109 (= L106)
Sites not aligning to the query:
4i49A Structure of ngnags bound with bisubstrate analog coa-NAG (see paper)
28% identity, 79% coverage: 3:127/158 of query aligns to 276:401/424 of 4i49A
- binding (2S)-2-({(3S,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14,20-trioxo-2,4,6-trioxa-18-thia-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaicosan-20-yl}amino)pentanedioic acid (non-preferred name): I300 (≠ Q27), L301 (≠ M28), L302 (= L29), R304 (= R31), A343 (≠ K70), C344 (≠ S71), L345 (= L72), A346 (= A73), V347 (= V74), Q352 (≠ H79), D353 (≠ R80), G355 (= G82), G357 (= G84), E358 (= E85), L379 (= L106), S380 (≠ T107), T383 (≠ P110), W386 (≠ F112), F387 (= F113)
Sites not aligning to the query:
- binding (2S)-2-({(3S,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14,20-trioxo-2,4,6-trioxa-18-thia-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaicosan-20-yl}amino)pentanedioic acid (non-preferred name): 413, 415
3d2mA Crystal structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and l-glutamate (see paper)
28% identity, 79% coverage: 3:127/158 of query aligns to 276:401/424 of 3d2mA
- binding coenzyme a: L345 (= L72), V347 (= V74), Q352 (≠ H79), D353 (≠ R80), G355 (= G82), G357 (= G84), E358 (= E85), S380 (≠ T107), T383 (≠ P110), W386 (≠ F112)
- binding glutamic acid: L302 (= L29), R304 (= R31), A343 (≠ K70), C344 (≠ S71), L379 (= L106)
Sites not aligning to the query:
3b8gA Crysta structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and n-acetyl-glutamate (see paper)
28% identity, 79% coverage: 3:127/158 of query aligns to 276:401/424 of 3b8gA
- binding coenzyme a: I300 (≠ Q27), L345 (= L72), V347 (= V74), Q352 (≠ H79), D353 (≠ R80), G355 (= G82), Y356 (≠ L83), G357 (= G84), E358 (= E85), S380 (≠ T107), T383 (≠ P110), E385 (vs. gap), W386 (≠ F112)
- binding n-acetyl-l-glutamate: L302 (= L29), R304 (= R31), A343 (≠ K70), C344 (≠ S71), L379 (= L106)
Sites not aligning to the query:
2r8vA Native structure of n-acetylglutamate synthase from neisseria gonorrhoeae (see paper)
28% identity, 79% coverage: 3:127/158 of query aligns to 276:401/424 of 2r8vA
- binding acetyl coenzyme *a: I300 (≠ Q27), L301 (≠ M28), L345 (= L72), V347 (= V74), Q352 (≠ H79), D353 (≠ R80), G355 (= G82), G357 (= G84), E358 (= E85), T383 (≠ P110), E385 (vs. gap), W386 (≠ F112), F387 (= F113)
Sites not aligning to the query:
3d2pA Crystal structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and l-arginine (see paper)
29% identity, 63% coverage: 28:127/158 of query aligns to 305:405/424 of 3d2pA
Sites not aligning to the query:
- active site: 26
- binding arginine: 13, 197, 216, 253, 266, 267, 269, 270, 271, 274, 276
- binding coenzyme a: 303
6yugA Crystal structure of c. Parvum gna1 in complex with acetyl-coa and glucose 6p. (see paper)
24% identity, 61% coverage: 2:97/158 of query aligns to 4:106/143 of 6yugA
- binding acetyl coenzyme *a: H80 (≠ S71), V81 (≠ L72), I82 (≠ A73), I83 (≠ V74), R88 (≠ H79), N89 (≠ R80), R90 (≠ Q81), G91 (= G82), G93 (= G84), R94 (≠ E85)
- binding 6-O-phosphono-alpha-D-glucopyranose: R26 (≠ D24), E79 (≠ K70), H80 (≠ S71)
Sites not aligning to the query:
Query Sequence
>WP_010936234.1 NCBI__GCF_000011905.1:WP_010936234.1
MYTIDKATIKDATTIHKLVNNFADHGQMLARSLAEIYENLRDFYVIRGDNGEVIACAALH
ISWADLAEVKSLAVSEERHRQGLGEMVVKACLEDAKSLQIPTVFCLTYKPAFFAKCGFHQ
VEKNALPHKIWGECYRCPKFPNCDETAMMLSLTEANIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory