SitesBLAST
Comparing WP_010936624.1 NCBI__GCF_000011905.1:WP_010936624.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
49% identity, 35% coverage: 82:128/136 of query aligns to 547:592/599 of 7q4vB
- binding iron/sulfur cluster: C551 (= C86), K552 (≠ T87), G553 (≠ H88), C554 (= C89), G555 (= G90), I556 (≠ A91), C557 (= C92), C561 (= C96), P562 (= P97), Y574 (≠ I110), C581 (= C117), K583 (≠ V119), C584 (= C120), G585 (= G121), A586 (≠ I122), C587 (= C123), C591 (= C127)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16, 48, 49, 51, 52
- binding flavin mononucleotide: 166, 168, 196, 198, 284, 287, 288, 289, 324
- binding iron/sulfur cluster: 457, 458, 459, 460, 463, 503, 506, 544, 593, 595
- binding zinc ion: 440, 527, 533
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
49% identity, 35% coverage: 82:128/136 of query aligns to 418:463/470 of 7q4vF
- binding iron/sulfur cluster: C422 (= C86), G424 (≠ H88), C425 (= C89), G426 (= G90), I427 (≠ A91), C428 (= C92), C432 (= C96), P433 (= P97), I437 (≠ F101), Y445 (≠ I110), C452 (= C117), K454 (≠ V119), C455 (= C120), G456 (= G121), A457 (≠ I122), C458 (= C123), C462 (= C127), P463 (= P128)
Sites not aligning to the query:
- binding flavin mononucleotide: 37, 39, 67, 158, 159, 160, 375
- binding nicotinamide-adenine-dinucleotide: 40, 43, 48, 177, 180, 297
- binding iron/sulfur cluster: 327, 328, 329, 330, 331, 334, 373, 374, 415, 417, 467
- binding zinc ion: 311, 398, 404, 409
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
49% identity, 35% coverage: 82:128/136 of query aligns to 395:440/447 of 8a5eB
- binding iron/sulfur cluster: C399 (= C86), G401 (≠ H88), C402 (= C89), G403 (= G90), C405 (= C92), C409 (= C96), P410 (= P97), I414 (≠ F101), C429 (= C117), K431 (≠ V119), C432 (= C120), G433 (= G121), C435 (= C123), C439 (= C127), P440 (= P128)
Sites not aligning to the query:
- binding flavin mononucleotide: 14, 16, 44, 135, 137, 171, 172, 352
- binding 1,4-dihydronicotinamide adenine dinucleotide: 16, 17, 20, 25, 28, 49, 154, 157, 250
- binding iron/sulfur cluster: 151, 305, 306, 307, 308, 311, 351, 354, 392, 444
- binding zinc ion: 288, 375, 381, 386
6x6uB Wor5 from pyrococcus furiosus, taurine-bound (see paper)
33% identity, 66% coverage: 39:128/136 of query aligns to 7:96/167 of 6x6uB
- binding phosphate ion: D10 (= D42)
- binding iron/sulfur cluster: C12 (vs. gap), S13 (≠ E44), C15 (≠ L46), R16 (≠ M47), C18 (≠ L49), C22 (≠ G53), H26 (≠ D59), R36 (≠ G69), I37 (≠ V70), V39 (≠ I72), C52 (= C86), V53 (≠ T87), C55 (= C89), P59 (≠ A91), C60 (= C92), C64 (= C96), P65 (= P97), L69 (≠ F101), C85 (= C117), I86 (= I118), T87 (≠ V119), C88 (= C120), G89 (= G121), C91 (= C123), C95 (= C127)
Sites not aligning to the query:
- binding phosphate ion: 128, 130, 161, 162
- binding iron/sulfur cluster: 100, 112, 113, 114, 115, 119, 121, 125, 130, 133
7arcI Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
36% identity, 41% coverage: 77:132/136 of query aligns to 91:154/199 of 7arcI
- binding iron/sulfur cluster: C100 (= C86), I101 (≠ T87), S102 (≠ H88), C103 (= C89), K104 (≠ G90), C106 (= C92), C110 (= C96), P111 (= P97), I115 (≠ F101), Y132 (≠ I110), C139 (= C117), I140 (= I118), Y141 (≠ V119), C142 (= C120), G143 (= G121), F144 (≠ I122), C145 (= C123), C149 (= C127), A153 (= A131), I154 (≠ M132)
- binding : R131 (vs. gap)
Sites not aligning to the query:
8e73S8 qcr9 (see paper)
36% identity, 41% coverage: 77:132/136 of query aligns to 73:136/181 of 8e73S8
- binding iron/sulfur cluster: C82 (= C86), I83 (≠ T87), C85 (= C89), K86 (≠ G90), C88 (= C92), C92 (= C96), I97 (≠ F101), C121 (= C117), I122 (= I118), Y123 (≠ V119), C124 (= C120), G125 (= G121), F126 (≠ I122), C127 (= C123), C131 (= C127), P132 (= P128), A135 (= A131), I136 (≠ M132)
Sites not aligning to the query:
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
33% identity, 53% coverage: 61:132/136 of query aligns to 128:208/348 of 5t61L
- binding iron/sulfur cluster: I129 (= I62), I146 (≠ V79), C153 (= C86), C156 (= C89), C159 (= C92), C163 (= C96), P164 (= P97), I168 (≠ F101), I186 (= I110), C193 (= C117), H195 (≠ V119), C196 (= C120), G197 (= G121), C199 (= C123), C203 (= C127), P204 (= P128), I208 (≠ M132)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 70, 71, 72, 73, 74, 76, 80, 85, 114, 117, 118, 120, 124, 212, 215, 238, 239, 240, 241, 242, 244, 248, 249, 270, 272, 273, 274, 276, 280, 281, 284, 307, 308, 309, 310, 311, 313, 317
7np8B Crystal structure of the coenzyme f420-dependent sulfite reductase from methanocaldococcus jannaschii at 2.3-a resolution (see paper)
36% identity, 49% coverage: 68:134/136 of query aligns to 483:541/620 of 7np8B
- binding iron/sulfur cluster: P488 (≠ D73), C495 (= C86), N496 (≠ T87), G497 (≠ H88), C498 (= C89), G499 (= G90), C501 (= C92), C505 (= C96), I510 (≠ F101), S517 (≠ R108), C524 (= C117), V525 (≠ I118), G526 (≠ V119), C527 (= C120), G528 (= G121), C530 (= C123), C534 (= C127), N536 (≠ P129), A538 (= A131), R539 (≠ M132)
- binding siroheme: K506 (≠ P97)
Sites not aligning to the query:
- binding calcium ion: 85, 228, 273
- binding flavin-adenine dinucleotide: 83, 84, 85, 87, 88, 89, 90, 107, 108, 129, 130, 131, 132, 133, 134, 137, 156, 199, 200, 202, 271, 272, 273, 281
- binding iron/sulfur cluster: 6, 15, 16, 17, 18, 19, 21, 25, 26, 29, 30, 36, 42, 44, 46, 48, 50, 54, 55, 159, 160, 180, 201, 202, 203, 204, 256, 259, 315, 428, 434, 436, 437, 467, 468, 470, 472
- binding sulfite ion: 355, 423, 460, 462
- binding siroheme: 355, 384, 386, 387, 388, 392, 429, 434, 459, 460, 462, 470, 472, 474, 553, 554, 555, 556, 594
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
41% identity, 36% coverage: 84:132/136 of query aligns to 580:627/630 of 8a6tB
- binding iron/sulfur cluster: C582 (= C86), I583 (≠ T87), C585 (= C89), C588 (= C92), C592 (= C96), A596 (= A100), I597 (≠ F101), I607 (≠ F112), C612 (= C117), C618 (= C123), C622 (= C127), K624 (≠ P129), A626 (= A131), I627 (≠ M132)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding flavin mononucleotide: 201, 227, 230, 355, 535, 536
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 320, 337, 340, 341, 342, 433
- binding iron/sulfur cluster: 487, 488, 489, 491, 494, 534, 536, 537, 575, 577
- binding zinc ion: 471, 558, 564
Q9VF27 NADH dehydrogenase (ubiquinone) 23 kDa subunit; EC 7.1.1.2 from Drosophila melanogaster (Fruit fly) (see paper)
35% identity, 38% coverage: 77:128/136 of query aligns to 109:168/217 of Q9VF27
Sites not aligning to the query:
- 199 G→D: Disrupts mitochondrial function and results in enlarged mitochondria. Neurons present vacuolar lesions leading to neurodegeneration in the central brain. Results in behavioral defects and shorten lifespan.
7npaA Crystal structure of the coenzyme f420-dependent sulfite reductase from methanothermococcus thermolithotrophicus at 1.55-a resolution (see paper)
40% identity, 35% coverage: 82:128/136 of query aligns to 491:535/618 of 7npaA
- binding iron/sulfur cluster: C495 (= C86), N496 (≠ T87), G497 (≠ H88), C498 (= C89), G499 (= G90), C501 (= C92), C505 (= C96), I507 (≠ V98), A509 (= A100), I510 (≠ F101), S517 (≠ R108), C524 (= C117), I525 (= I118), G526 (≠ V119), C527 (= C120), G528 (= G121), C530 (= C123), C534 (= C127)
- binding siroheme: K506 (≠ P97)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 83, 84, 85, 87, 88, 89, 90, 107, 108, 129, 131, 132, 133, 134, 137, 156, 158, 199, 200, 201, 202, 272, 273, 274, 281
- binding iron/sulfur cluster: 15, 16, 17, 18, 19, 21, 25, 30, 36, 42, 44, 46, 48, 50, 54, 55, 159, 160, 180, 201, 202, 203, 204, 256, 259, 315, 428, 434, 436, 437, 467, 468, 470, 472, 488, 536, 538, 539
- binding siroheme: 353, 355, 384, 386, 387, 388, 392, 394, 428, 429, 434, 459, 460, 462, 470, 472, 474, 553, 554, 555, 556, 594
7b0nI 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
35% identity, 38% coverage: 77:128/136 of query aligns to 83:142/191 of 7b0nI
- binding iron/sulfur cluster: C92 (= C86), I93 (≠ T87), A94 (≠ H88), C95 (= C89), K96 (≠ G90), C98 (= C92), C102 (= C96), C131 (= C117), I132 (= I118), Y133 (≠ V119), C134 (= C120), G135 (= G121), C137 (= C123), C141 (= C127)
Sites not aligning to the query:
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
37% identity, 38% coverage: 82:133/136 of query aligns to 563:613/613 of 7p8nB
- binding iron/sulfur cluster: C567 (= C86), C570 (= C89), G571 (= G90), C573 (= C92), C577 (= C96), Y590 (≠ I110), I592 (≠ F112), C597 (= C117), K599 (≠ V119), C600 (= C120), G601 (= G121), C603 (= C123), C607 (= C127)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 34, 36, 67, 68, 69, 70, 71
- binding flavin mononucleotide: 185, 186, 187, 213, 215, 216, 217, 301, 304, 305, 306, 340, 341, 521, 522
- binding iron/sulfur cluster: 320, 473, 474, 475, 476, 477, 480, 519, 520, 522, 523, 560
- binding zinc ion: 457, 544, 549, 554
8b9zI Drosophila melanogaster complex i in the active state (dm1) (see paper)
34% identity, 41% coverage: 77:132/136 of query aligns to 78:141/186 of 8b9zI
- binding iron/sulfur cluster: C87 (= C86), I88 (≠ T87), A89 (≠ H88), C90 (= C89), K91 (≠ G90), C93 (= C92), C97 (= C96), P98 (= P97), Y119 (≠ I110), C126 (= C117), I127 (= I118), Y128 (≠ V119), C129 (= C120), G130 (= G121), F131 (≠ I122), C132 (= C123), C136 (= C127), A140 (= A131), I141 (≠ M132)
Sites not aligning to the query:
5gupH structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
35% identity, 38% coverage: 77:128/136 of query aligns to 68:127/176 of 5gupH
- binding iron/sulfur cluster: C77 (= C86), I78 (≠ T87), A79 (≠ H88), C80 (= C89), K81 (≠ G90), C83 (= C92), C87 (= C96), C116 (= C117), I117 (= I118), Y118 (≠ V119), C119 (= C120), G120 (= G121), F121 (≠ I122), C122 (= C123), C126 (= C127), P127 (= P128)
- binding : R108 (≠ E109)
Sites not aligning to the query:
- binding (9r,11s)-9-({[(1s)-1-hydroxyhexadecyl]oxy}methyl)-2,2-dimethyl-5,7,10-trioxa-2lambda~5~-aza-6lambda~5~-phosphaoctacosane-6,6,11-triol: 24, 27, 30
- binding iron/sulfur cluster: 65, 130, 131
- binding : 150
7ak5I Cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a (see paper)
35% identity, 38% coverage: 77:128/136 of query aligns to 70:129/178 of 7ak5I
- binding iron/sulfur cluster: C79 (= C86), I80 (≠ T87), A81 (≠ H88), C82 (= C89), K83 (≠ G90), C85 (= C92), C89 (= C96), C118 (= C117), I119 (= I118), Y120 (≠ V119), C121 (= C120), G122 (= G121), C124 (= C123), C128 (= C127)
Sites not aligning to the query:
7zm7I Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
33% identity, 38% coverage: 77:128/136 of query aligns to 77:136/185 of 7zm7I
- binding iron/sulfur cluster: C86 (= C86), I87 (≠ T87), A88 (≠ H88), C89 (= C89), K90 (≠ G90), C92 (= C92), C96 (= C96), P97 (= P97), I101 (≠ F101), Y118 (≠ I110), C125 (= C117), I126 (= I118), Y127 (≠ V119), C128 (= C120), C131 (= C123), C135 (= C127)
Sites not aligning to the query:
6cfwN Cryoem structure of a respiratory membrane-bound hydrogenase (see paper)
28% identity, 43% coverage: 78:135/136 of query aligns to 37:94/121 of 6cfwN
- binding iron/sulfur cluster: C45 (= C86), G47 (≠ H88), C48 (= C89), M50 (≠ A91), C51 (= C92), C55 (= C96), C76 (= C117), M78 (≠ V119), C79 (= C120), C82 (= C123), C86 (= C127)
8b6fAL ndutt15 (see paper)
34% identity, 41% coverage: 77:132/136 of query aligns to 109:172/218 of 8b6fAL
- binding iron/sulfur cluster: C118 (= C86), I119 (≠ T87), C121 (= C89), K122 (≠ G90), C124 (= C92), C128 (= C96), I133 (≠ F101), Y150 (≠ I110), C157 (= C117), I158 (= I118), Y159 (≠ V119), C160 (= C120), G161 (= G121), C163 (= C123), C167 (= C127), P168 (= P128), A171 (= A131), I172 (≠ M132)
Sites not aligning to the query:
7p63I Complex i from e. Coli, ddm/lmng-purified, under turnover at ph 6, closed state (see paper)
38% identity, 39% coverage: 82:134/136 of query aligns to 56:116/180 of 7p63I
- binding iron/sulfur cluster: C60 (= C86), V61 (≠ T87), A62 (≠ H88), C63 (= C89), N64 (≠ G90), C66 (= C92), C70 (= C96), C74 (≠ A100), I75 (≠ F101), F92 (vs. gap), C99 (= C117), I100 (= I118), F101 (≠ V119), C102 (= C120), G103 (= G121), L104 (≠ I122), C105 (= C123), C109 (= C127), P110 (= P128), T111 (≠ P129), I114 (≠ M132)
Sites not aligning to the query:
Query Sequence
>WP_010936624.1 NCBI__GCF_000011905.1:WP_010936624.1
MKTSKRIVLRFPQRLVDRPIVYHLIRDFDLAFNILKASITPDKEGLMVLEITGEREAYDK
GIAYLNEAGVKIDSLNREVTRNENRCTHCGACVTMCPVDAFSIDEDNREINFDAKKCIVC
GICIQACPPRAMELHF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory