Comparing WP_010937222.1 NCBI__GCF_000011905.1:WP_010937222.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
2qmxA The crystal structure of l-phe inhibited prephenate dehydratase from chlorobium tepidum tls (see paper)
36% identity, 96% coverage: 4:268/276 of query aligns to 4:273/278 of 2qmxA
6vh5D Crystal structure of prephenate dehydratase from brucella melitensis biovar abortus 2308 in complex with phenylalanine
32% identity, 98% coverage: 3:273/276 of query aligns to 8:281/282 of 6vh5D
P0A9J8 Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 from Escherichia coli (strain K12)
31% identity, 98% coverage: 3:273/276 of query aligns to 105:380/386 of P0A9J8
Sites not aligning to the query:
7am0B Gqqa- a novel type of quorum quenching acylases (see paper)
31% identity, 96% coverage: 4:268/276 of query aligns to 4:269/278 of 7am0B
3mwbB The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
30% identity, 95% coverage: 8:270/276 of query aligns to 7:273/303 of 3mwbB
3mwbA The crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a
30% identity, 95% coverage: 8:270/276 of query aligns to 7:276/306 of 3mwbA
3luyA Putative chorismate mutase from bifidobacterium adolescentis
22% identity, 90% coverage: 23:270/276 of query aligns to 32:285/326 of 3luyA
7alzA Gqqa- a novel type of quorum quenching acylases (see paper)
33% identity, 36% coverage: 170:268/276 of query aligns to 84:185/194 of 7alzA
>WP_010937222.1 NCBI__GCF_000011905.1:WP_010937222.1
MIKISIQGARGSFHDIVARHKFPGDSEIIESDTSHQVFEDVKKGLADYGVVAIENSLYGS
FLDNYDNLLKYESKIVGETYLHVILNLIALPGVKMEQIHEVYTHPIAMIQAESFLEKHPS
VIRIEGYDTAGSVRMIKEKNLTTAAAISSNLSAQLYDMKILAKDIETEKQNYTRFLIIAK
EPKYPPQANKTSLAIKAENNAGSLYKCLKCFYDQGINLSKIESRPVMGRTWGYYFYLDFE
RGLNTPETQRALKELAKVTETIHVLGSYEQGSVFEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory