Comparing WP_010937305.1 NCBI__GCF_000011905.1:WP_010937305.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
2zktB Structure of ph0037 protein from pyrococcus horikoshii
32% identity, 98% coverage: 2:388/393 of query aligns to 5:366/381 of 2zktB
2zktA Structure of ph0037 protein from pyrococcus horikoshii
41% identity, 25% coverage: 2:101/393 of query aligns to 6:105/330 of 2zktA
Sites not aligning to the query:
7tl8A 1.95a resolution structure of independent phosphoglycerate mutase from s. Aureus in complex with a macrocyclic peptide inhibitor (sa-d3) (see paper)
31% identity, 23% coverage: 281:369/393 of query aligns to 364:461/488 of 7tl8A
Sites not aligning to the query:
4nwxA Crystal structure of phosphoglycerate mutase from staphylococcus aureus in 2-phosphoglyceric acid bound form (see paper)
31% identity, 22% coverage: 281:368/393 of query aligns to 379:475/503 of 4nwxA
Sites not aligning to the query:
4nwjA Crystal structure of phosphopglycerate mutase from staphylococcus aureus in 3-phosphoglyceric acid bound form. (see paper)
31% identity, 22% coverage: 281:368/393 of query aligns to 380:476/504 of 4nwjA
Sites not aligning to the query:
>WP_010937305.1 NCBI__GCF_000011905.1:WP_010937305.1
MKYCVLITDGASGWGIKEQGGKTALELARTPNLDKMAKNGFMGQSANVPPGMEPSSACAC
MSLLGYDPEIYYKGRAAIEAVSMGVDVAPDEVVFRCNLVSVIDGKMASYSAGHISSEEAA
ELLEAVAKELGSERVKFYPGVNYRHLLKLKGMGDTAKALCTPPHDISDREVSPYLPQGEG
SLILNQLISSSQQILKDHPLNLRRQSQGKLPANSIWLFWGSGPIPPMPSFKKAYGLDAVL
NSGVDLLRGLGIMMNMKILELNGITDGLNNDFSGQMRGGLLALGDNDLAVIHVEAPDEAG
HAGSLADKVKAIELIDELMVGQLLAYPEDIRVLVTPDHPTPLELKTHVAEPVPFLMWGKG
VASNGVSRFTEKEAAKTGIIFEKGCNLMQAFLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory