Comparing WP_010961246.1 NCBI__GCF_000008325.1:WP_010961246.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
66% identity, 98% coverage: 4:244/245 of query aligns to 9:246/247 of 3op4A
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
67% identity, 98% coverage: 4:244/245 of query aligns to 6:243/244 of P0AEK2
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
67% identity, 98% coverage: 4:244/245 of query aligns to 5:242/243 of 1q7bA
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
67% identity, 98% coverage: 4:244/245 of query aligns to 5:242/243 of 1q7cA
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
66% identity, 98% coverage: 4:244/245 of query aligns to 6:243/244 of P0A2C9
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
66% identity, 98% coverage: 4:244/245 of query aligns to 6:243/244 of 6t77A
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
64% identity, 98% coverage: 4:244/245 of query aligns to 9:242/243 of 4i08A
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
64% identity, 100% coverage: 1:244/245 of query aligns to 10:253/254 of 4ag3A
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
63% identity, 98% coverage: 4:244/245 of query aligns to 5:242/243 of 7emgB
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
63% identity, 100% coverage: 1:244/245 of query aligns to 16:254/255 of 4bo4C
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
61% identity, 100% coverage: 1:244/245 of query aligns to 5:240/241 of 4bnzA
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
61% identity, 100% coverage: 1:244/245 of query aligns to 4:238/239 of 4bnyA
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
61% identity, 100% coverage: 1:244/245 of query aligns to 5:239/239 of 4bnxA
4bnuA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2-phenyl-4-(1,2,4- triazol-4-yl)quinazoline at 2.0a resolution (see paper)
60% identity, 100% coverage: 1:244/245 of query aligns to 5:238/239 of 4bnuA
4bo7A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2,3-dihydro-1h-inden- 5-yl)tetrazolo(1,5-b)pyridazin-6-amine at 2.6a resolution (see paper)
60% identity, 100% coverage: 1:244/245 of query aligns to 5:237/238 of 4bo7A
4bo8A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(2-amino-4- phenylimidazol-1-yl)-3-(2-fluorophenyl)urea at 2.7a resolution (see paper)
59% identity, 100% coverage: 1:244/245 of query aligns to 5:235/236 of 4bo8A
4bo0A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(4-methoxy-1- methylindazol-3-yl)-3-(2-methoxyphenyl)urea at 2.4a resolution (see paper)
59% identity, 100% coverage: 1:244/245 of query aligns to 4:234/235 of 4bo0A
4bo2A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(1-ethylbenzimidazol-2- yl)-3-(2-methoxyphenyl)urea at 1.9a resolution (see paper)
59% identity, 100% coverage: 1:244/245 of query aligns to 7:237/238 of 4bo2A
4bo9A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 5-(2-(furan-2-ylmethoxy) phenyl)-2-phenyltetrazole at 2.9a resolution (see paper)
59% identity, 100% coverage: 1:244/245 of query aligns to 5:234/235 of 4bo9A
4bo3A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2-(3-(trifluoromethyl) anilino)pyridine-3-sulfonamide at 2.5a resolution (see paper)
59% identity, 100% coverage: 1:244/245 of query aligns to 3:232/233 of 4bo3A
>WP_010961246.1 NCBI__GCF_000008325.1:WP_010961246.1
MTDQIAIVTGASRGIGRAIAHRLAQAGHTVVGTATSEDGAAAIGSALTDAGLNGCGRVLD
VSDPASVEAFVAAVSDEFGIPTILVNNAGITRDGLLMRMKDEDWDAIIDTNLSSVYRMSK
ACLKGMMKARTGRIVNITSVVGLTGNAGQTNYAAAKAGIIGFTKSLAKEIGSRGITVNSV
APGFIDTDMTRALPEAHKTALLASIPLGRLGQAEEIAGAVAFLCSDDAAYITGETLHVNG
GMFMP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory