Comparing WP_010966449.1 NCBI__GCF_000008765.1:WP_010966449.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
48% identity, 98% coverage: 1:160/163 of query aligns to 1:158/167 of 2pkpA
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
48% identity, 98% coverage: 1:160/163 of query aligns to 1:158/170 of Q58667
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 79% coverage: 13:141/163 of query aligns to 554:698/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 61% coverage: 13:111/163 of query aligns to 18:119/198 of P9WK95
Sites not aligning to the query:
P09339 Aconitate hydratase A; ACN; Aconitase; Aconitate/2-methylaconitate hydratase; Iron-responsive protein-like; IRP-like; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.- from Bacillus subtilis (strain 168) (see 2 papers)
35% identity, 49% coverage: 47:126/163 of query aligns to 774:857/909 of P09339
Sites not aligning to the query:
P19414 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
51% identity, 25% coverage: 54:94/163 of query aligns to 655:695/778 of P19414
Sites not aligning to the query:
A0QX20 Aconitate hydratase A; ACN; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.99 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
39% identity, 45% coverage: 54:126/163 of query aligns to 811:884/943 of A0QX20
Sites not aligning to the query:
>WP_010966449.1 NCBI__GCF_000008765.1:WP_010966449.1
MKVNGDVLKYGDNIDTDVIIPARYLNTSVPEELAKHCMEDLDVDFLKKLKTGDIVVGGRN
FGCGSSREHAPICIKAAGVSCVIAKSFARIFYRNSINIGFPILECEEAVNDASTGDKLEV
DFIEGIIKNVTLNKEYKAQPFPDFMLKIMKNEGLTNCVKKGLF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory