Comparing WP_011022159.1 NCBI__GCF_000007345.1:WP_011022159.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 76% coverage: 44:182/184 of query aligns to 47:184/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
33% identity, 76% coverage: 44:182/184 of query aligns to 46:183/200 of 1krrA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
33% identity, 76% coverage: 44:182/184 of query aligns to 46:183/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
33% identity, 76% coverage: 44:182/184 of query aligns to 46:183/201 of 1kruA
Sites not aligning to the query:
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
39% identity, 76% coverage: 44:182/184 of query aligns to 46:183/186 of 4isxA
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
34% identity, 79% coverage: 39:184/184 of query aligns to 41:185/185 of 3nz2J
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
34% identity, 79% coverage: 39:184/184 of query aligns to 31:175/176 of 3ectA
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
34% identity, 79% coverage: 39:184/184 of query aligns to 38:182/183 of 3nz2C
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
39% identity, 50% coverage: 91:182/184 of query aligns to 95:183/190 of 5u2kA
Sites not aligning to the query:
8j40A Crystal structure of catb8 in complex with chloramphenicol (see paper)
59% identity, 29% coverage: 130:183/184 of query aligns to 110:163/209 of 8j40A
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
39% identity, 58% coverage: 77:183/184 of query aligns to 52:166/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
39% identity, 58% coverage: 77:183/184 of query aligns to 52:166/211 of 4hurA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
39% identity, 58% coverage: 77:183/184 of query aligns to 52:166/207 of 6x3cA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
39% identity, 58% coverage: 77:183/184 of query aligns to 52:166/203 of 6x3cE
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
39% identity, 58% coverage: 77:183/184 of query aligns to 52:166/206 of 6x3jA
Sites not aligning to the query:
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
52% identity, 34% coverage: 122:183/184 of query aligns to 101:162/208 of 2xatA
Sites not aligning to the query:
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
43% identity, 51% coverage: 90:182/184 of query aligns to 189:279/307 of A1ADJ6
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
47% identity, 49% coverage: 91:181/184 of query aligns to 97:184/188 of 3igjC
Sites not aligning to the query:
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
34% identity, 76% coverage: 45:183/184 of query aligns to 32:162/206 of 6u9cA
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
34% identity, 76% coverage: 45:183/184 of query aligns to 35:165/210 of 6pubA
Sites not aligning to the query:
>WP_011022159.1 NCBI__GCF_000007345.1:WP_011022159.1
MKSKVINYLKSLEKYTALIFYYSIARHLPPSDEPQSLKLSKPIRGFLASKIFDECGVGVN
LEKGAYIADGKFIRVGNYSGIGINSLVQRNVSIGNDVMMGRDVIIMTTSHETSDASIPMR
YQGGKEVSPVIIGDDVWIGSRVIILPGVRIGTGSIIGAGAVVTRDVEPYSVVGGTPAKII
KKRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory